Recombinant Human Transmembrane protein 229A (TMEM229A)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary based on the purchase method or location. For specific delivery details, please consult your local distributor.
As a standard practice, all our proteins are shipped with regular blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference point.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
TMEM229A; Transmembrane protein 229A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-380
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMEM229A
Target Protein Sequence
MAGSDVDSEGPARRGGAARRPGAPGGPGSEAAAGCPEPLSTAEAPAESATLPAWMRLYFY GMHGITLDVLVSSARRFARSPDLRMLGFSSPYRCLLHSLTHFALEKVYLQQRRCPNAFVF NFLLYPSAHVGLQTLAGQALLLSLGGGAGVAVAPGALDLALQYVLALYHCQVFLKRFLRL RYGRQRRRQQQQQQQQQQQQRRGALPVPPGARVPTAAGARRRRPRGPRGAGGAPSQGLPD LPRFLFFGMHGFLDEIFFTFFFNVLGQGDGTTSGHTSLWSFFMYGSCSFVVEKLYFHLHY SRGWGTWKRVPIYVIFIYVWELSWGLGLRTCGACSWDYSHYPLNFMGLITLMYLPGWIFL SVYQDLISNVLWRVQYVPAN
Uniprot No.

Target Background

Database Links

HGNC: 37279

KEGG: hsa:730130

STRING: 9606.ENSP00000395244

UniGene: Hs.450249

Protein Families
TMEM229 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TMEM229A and what is its biological significance?

TMEM229A (Transmembrane protein 229A) is a member of the TMEM family that was initially identified to play important roles in tooth differentiation and development. Recent research has revealed its significant involvement in cancer biology, particularly in non-small cell lung cancer (NSCLC) . While previously understudied in oncology contexts, TMEM229A has emerged as a protein of interest due to its apparent tumor-suppressive properties. The protein is expressed in normal lung tissues but shows significantly downregulated expression in NSCLC tissues and several NSCLC cell lines compared to adjacent normal lung tissues and normal bronchial epithelial cells .

How is TMEM229A expression regulated in different tissues?

TMEM229A expression varies across tissue types, with notable expression in normal lung tissue. In pathological contexts, TMEM229A shows significant downregulation in NSCLC tissues compared to adjacent normal tissues . Survival analysis of lung adenocarcinoma and squamous cell lung carcinoma cases identified that low TMEM229A expression was associated with a poor prognosis, suggesting its expression is clinically relevant . The mechanisms regulating TMEM229A expression remain largely unexplored, presenting an important area for future research to elucidate the transcriptional and post-transcriptional controls that govern its tissue-specific expression patterns.

What are the experimental challenges in studying transmembrane proteins like TMEM229A?

Studying transmembrane proteins presents several experimental challenges due to their hydrophobic nature and membrane integration. Unlike soluble proteins, recombinant expression of membrane proteins like TMEM229A often results in variable yields, with some proteins accumulating in the membrane to high levels, while others are barely detected .

Successful overproduction of membrane proteins has been linked to avoiding stress responses in the host cell. Research has shown that the cell response to membrane protein production can be quantified, with several genes being either upregulated or downregulated when yields of a membrane-inserted protein are poor . Additionally, understanding how the translocon (the site of protein translocation and membrane insertion) determines whether a protein segment is integrated into the membrane is crucial for optimizing expression systems .

What role does TMEM229A play in non-small cell lung cancer progression?

TMEM229A functions as a tumor suppressor in non-small cell lung cancer (NSCLC). In vitro studies have demonstrated that overexpression of TMEM229A significantly inhibits cell proliferation, migration, and invasion in NSCLC cell lines, while TMEM229A knockdown produces the opposite effect . The tumor-suppressive function of TMEM229A is partly mediated through its inhibitory effects on the epithelial-mesenchymal transition (EMT) process, a critical step in cancer metastasis.

Mechanistically, TMEM229A overexpression effectively increases E-cadherin expression while reducing N-cadherin, snail family transcriptional repressor 1, and MMP2 expression, indicating EMT suppression . Additionally, TMEM229A reduces the expression levels of phosphorylated ERK and phosphorylated AKT, suggesting that it inhibits these pro-oncogenic signaling pathways to exert its tumor-suppressive effects .

How does TMEM229A expression correlate with clinical outcomes in NSCLC?

TMEM229A expression shows significant correlation with several clinical parameters and outcomes in NSCLC. According to clinical data from patients with NSCLC, low TMEM229A expression is associated with poor prognosis . The relationship between TMEM229A expression and various clinicopathological features is summarized in the following table:

VariablesN=189Low TMEM229AHigh TMEM229Aχ²P-value
Sex0.0580.810
Female905337
Male996039
Age1.8830.170
>65884840
≤651016536
Smoking history0.6900.406
Ever955441
Never945935
Tumor size (cm)0.0090.925
>3.0543222
≤3.01358154
Histological type0.7070.863
Squamous cell carcinoma472819
Adenocarcinoma1419457
Large cell carcinoma110
Tumor differentiation3.6270.043

Notably, TMEM229A expression shows a significant correlation with tumor differentiation (p=0.043), suggesting its potential role in regulating cancer cell differentiation states .

What signaling pathways does TMEM229A affect in cancer cells?

TMEM229A affects several key signaling pathways that regulate cancer cell proliferation, migration, and invasion. Most prominently, TMEM229A overexpression reduces the levels of phosphorylated ERK and phosphorylated AKT (Ser473) . The effect on ERK signaling appears to be particularly important, as the incorporation of the specific ERK inhibitor PD98059 partially suppresses the tumor-suppressive effects of TMEM229A overexpression .

The ERK pathway is a crucial signaling cascade involved in regulating cell proliferation, differentiation, and survival. By inhibiting ERK phosphorylation, TMEM229A effectively suppresses the pro-oncogenic signals transmitted through this pathway. Similarly, the AKT pathway plays important roles in promoting cell growth, proliferation, and survival, and its inhibition by TMEM229A contributes to the tumor-suppressive effects .

What mutations have been identified in the TMEM229A gene in lung cancer?

A verification study using PCR and sequencing found that 16 out of 181 LUAD patients (8.8%) had the TMEM229A Q200del mutation, while R76H and M346T mutations were not detected in this cohort . This suggests that the frequency of TMEM229A mutations may vary across different patient populations or that different detection methods may yield different results.

How does the TMEM229A Q200del mutation affect lung adenocarcinoma progression?

The TMEM229A Q200del mutation appears to play a protective role in lung adenocarcinoma progression. Correlation analysis between the TMEM229A Q200del mutation and clinicopathological characteristics revealed that a lower frequency of the Q200del mutation was significantly associated with:

  • Positive lymph node metastasis (p = 0.043)

  • Advanced TNM stage (p = 0.035)

  • Positive cancer thrombus (p = 0.044)

  • Specific pathological features (p = 0.008)

Functional studies have shown that overexpression of TMEM229A Q200del suppresses NSCLC cell proliferation and migration in vitro. Mechanistically, both wild-type TMEM229A and TMEM229A Q200del reduce the expression levels of phosphorylated ERK and phosphorylated AKT (Ser473), but the reduction in phosphorylated ERK is more pronounced in cells expressing the Q200del mutant compared to those expressing wild-type TMEM229A . This suggests that the Q200del mutation enhances the tumor-suppressive function of TMEM229A, possibly by more effectively inhibiting the ERK signaling pathway.

How do the frequencies of TMEM229A mutations differ between studies?

The reported frequencies of TMEM229A mutations show notable variation between different studies and cohorts. In the TCGA-LUAD cohort, TMEM229A mutations (including Q200del, R76H, and M346T) were found in approximately 1% of patients . In contrast, a verification study using PCR and sequencing found that 16 out of 181 LUAD patients (8.8%) carried the TMEM229A Q200del mutation .

This discrepancy in mutation frequencies could be attributed to several factors:

  • Population differences: The genetic background of patients in different cohorts may influence mutation frequencies.

  • Methodological differences: Different detection methods (e.g., whole-exome sequencing vs. PCR-based approaches) may have different sensitivities and specificities.

  • Sample selection: Differences in patient selection criteria may result in cohorts with different mutation profiles.

  • Tumor heterogeneity: The spatial distribution of mutations within tumors may affect detection rates depending on which portion of the tumor was sampled.

Understanding these differences is crucial for accurately assessing the prevalence and clinical significance of TMEM229A mutations in lung cancer.

What are the optimal methods for detecting TMEM229A expression in clinical samples?

Based on current research, multiple complementary methods are recommended for detecting TMEM229A expression in clinical samples:

  • Reverse Transcription-Quantitative PCR (RT-qPCR): This method allows for sensitive quantification of TMEM229A mRNA expression levels. Studies have successfully used RT-qPCR to detect TMEM229A expression in NSCLC tissues and cell lines .

  • Western Blotting: This protein detection method has been effectively used to measure TMEM229A protein levels in tissue samples and cell lines . When performing western blotting for transmembrane proteins like TMEM229A, optimization of protein extraction methods is critical to ensure efficient solubilization of membrane-integrated proteins.

  • Immunohistochemical (IHC) Analysis: IHC enables visualization of TMEM229A expression and localization within tissue sections, providing spatial information that is not available with RT-qPCR or western blotting . This method is particularly valuable for correlating TMEM229A expression with histopathological features.

When analyzing clinical samples, it is advisable to use at least two of these methods to ensure reliable detection and quantification of TMEM229A expression.

What are the key considerations for recombinant expression of TMEM229A?

Recombinant expression of transmembrane proteins like TMEM229A presents several challenges that require careful consideration:

  • Selection of Expression System: Different host cells respond differently to membrane protein expression. Some proteins accumulate to high levels in certain hosts but are barely detected in others . For transmembrane proteins, bacterial systems like E. coli may not provide proper folding and post-translational modifications, making eukaryotic systems like insect cells or mammalian cells potentially more suitable.

  • Avoiding Host Cell Stress Responses: Successful overproduction of membrane proteins is linked to avoiding stress responses in the host cell . Monitoring and mitigating cellular stress during expression is crucial for optimal yields.

  • Optimization of Expression Conditions: Parameters such as temperature, induction time, and inducer concentration can significantly affect the yield and quality of recombinant membrane proteins. Lower temperatures often favor proper folding and membrane insertion.

  • Solubilization and Purification Strategies: Extracting membrane proteins from their native lipid environment requires appropriate detergents or lipid-based systems. The choice of detergent is critical for maintaining protein stability and functionality during purification.

  • Functional Validation: Ensuring that the recombinantly expressed TMEM229A retains its native structure and function is essential. Functional assays should be designed to verify that the protein behaves similarly to its endogenous counterpart.

How can experimental design be optimized for studying TMEM229A function?

Optimizing experimental design for studying TMEM229A function requires a systematic approach:

  • Clearly Defined Objectives: Establish specific research questions about TMEM229A function before designing experiments. For example, are you investigating its role in cell proliferation, migration, or signaling pathway regulation?

  • Appropriate Controls: Include proper controls such as:

    • Cells expressing empty vectors for comparison with TMEM229A-overexpressing cells

    • Cells treated with non-targeting siRNA/shRNA for comparison with TMEM229A-knockdown cells

    • Both gain-of-function (overexpression) and loss-of-function (knockdown) approaches to validate findings

  • Multiple Assay Systems: Employ diverse experimental approaches to assess TMEM229A function:

    • Cell Counting Kit-8 assays for cell proliferation

    • Colony formation and soft agar assays for anchorage-dependent and -independent growth

    • Real-time cellular analysis and Transwell assays for cell migration and invasion

    • Western blotting for signaling pathway analysis

  • Mechanistic Validation: Use pathway inhibitors (e.g., ERK inhibitor PD98059) to validate the involvement of specific signaling pathways in TMEM229A-mediated effects .

  • Genetic Manipulation: Consider generating stable cell lines with TMEM229A overexpression, knockdown, or expression of specific mutants (e.g., Q200del) to study long-term effects and avoid variability associated with transient transfection.

A well-designed experimental approach employing these considerations will yield more reliable and comprehensive insights into TMEM229A function.

How might TMEM229A and its mutations be exploited for cancer therapy?

TMEM229A's tumor-suppressive role suggests several potential therapeutic strategies:

  • Gene Therapy Approaches: Delivering functional TMEM229A or its more potent Q200del mutant to tumors with low TMEM229A expression could potentially suppress cancer progression. This approach would require development of efficient gene delivery systems targeting specific tumors.

  • Pathway-Based Therapeutics: Since TMEM229A exerts its tumor-suppressive effects partly through inhibiting the ERK signaling pathway, combining TMEM229A-targeting approaches with existing ERK pathway inhibitors might enhance therapeutic efficacy . The observation that the Q200del mutant more strongly inhibits ERK phosphorylation suggests that understanding the structural basis of this enhanced inhibition could lead to development of small molecules mimicking this effect.

  • Biomarker Development: TMEM229A expression levels and mutation status (particularly Q200del) could serve as prognostic biomarkers in NSCLC. Low TMEM229A expression is associated with poor prognosis , while the presence of the Q200del mutation correlates with less aggressive disease features . These markers could help stratify patients for different treatment approaches.

  • Screening for Small Molecules: High-throughput screening for compounds that upregulate TMEM229A expression or enhance its function could identify novel therapeutic candidates for NSCLC treatment.

  • Precision Medicine Approaches: Given the correlation between TMEM229A Q200del and favorable clinicopathological features , patients could be stratified based on TMEM229A mutation status for personalized treatment decisions.

What are the emerging questions about TMEM229A in the tumor microenvironment?

Several crucial questions remain unexplored regarding TMEM229A's role in the tumor microenvironment:

  • Intercellular Communication: Does TMEM229A expression in cancer cells affect their interaction with stromal cells, immune cells, or other components of the tumor microenvironment? As a transmembrane protein, TMEM229A might be involved in cell-cell communication or recognition.

  • Immune Response Modulation: Does TMEM229A affect the recruitment or function of immune cells within the tumor microenvironment? Understanding whether TMEM229A influences tumor immunogenicity or immune evasion could reveal new immunotherapeutic opportunities.

  • Extracellular Matrix Interaction: How does TMEM229A affect the production or remodeling of extracellular matrix components? The observation that TMEM229A suppresses MMP2 expression suggests it might influence matrix degradation and remodeling, which are crucial for cancer invasion and metastasis.

  • Angiogenesis Regulation: Does TMEM229A expression in cancer cells or tumor-associated endothelial cells affect tumor angiogenesis? As tumor growth depends on blood vessel formation, understanding TMEM229A's potential role in this process could reveal new anti-angiogenic strategies.

  • Metabolic Reprogramming: Does TMEM229A influence tumor metabolism? Changes in cellular metabolism are a hallmark of cancer, and investigating whether TMEM229A affects metabolic pathways could uncover new therapeutic vulnerabilities.

How do TMEM229A's functions compare across different cancer types?

While current research has focused primarily on TMEM229A's role in NSCLC, several important questions remain about its functions across different cancer types:

  • Expression Profile Comparison: How does TMEM229A expression vary across different cancer types and subtypes? Comprehensive analysis of TMEM229A expression in various cancer databases could reveal cancer-specific patterns.

  • Prognostic Value Assessment: Does TMEM229A's association with prognosis in NSCLC extend to other cancer types? Meta-analysis of survival data correlated with TMEM229A expression across multiple cancers could address this question.

  • Mutation Landscape Exploration: Are TMEM229A mutations, particularly Q200del, present in other cancer types? If so, do they correlate with similar clinicopathological features as observed in LUAD ?

  • Mechanism Conservation Evaluation: Is TMEM229A's inhibitory effect on the ERK pathway consistent across different cancer types, or does it regulate different signaling pathways depending on the cellular context?

  • Tissue-Specific Interactome Analysis: Does TMEM229A interact with different proteins in different tissues, leading to tissue-specific functions? Identifying TMEM229A's interaction partners in various cancer types could reveal context-dependent mechanisms.

Addressing these questions would provide a more comprehensive understanding of TMEM229A's role in cancer biology and potentially identify cancer types where TMEM229A-targeted therapies might be most effective.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.