Recombinant Human Transmembrane protein 229B (TMEM229B)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Gene Context

Gene Details

AttributeDescriptionSource
Chromosomal Location14q24.1 (sense strand)
Exons3 (primary transcript)
Transcript Variants7 (mRNA sizes: 519–5008 bp)
Neighboring GenesPIGH (GPI-anchor biosynthesis), PLEK2 (cytoskeletal regulation)

Protein Properties

AttributeDescriptionSource
Molecular Weight19,531 Da
DomainDUF1113 (aa 87–135)
Phosphorylation SiteThreonine-139
Predicted Structure4-pass transmembrane topology resembling connexin subunits

Tissue Expression and Localization

TMEM229B exhibits ubiquitous expression but is enriched in:

  • High-Expression Tissues: Parathyroid, skin, thyroid.

  • Moderate Expression: Bone marrow, spleen, brain, pancreas, liver, kidney.

  • Subcellular Localization: Cytoplasmic, granular pattern (Human Protein Atlas) .

Clinical and Disease Associations

Cancer-Related Overexpression
TMEM229B is elevated in:

  • Melanoma, breast carcinoma, colorectal adenocarcinoma, glioblastoma, and thyroid carcinoma.

  • No causal role established in oncogenesis .

Diabetes and Apoptosis

  • Downregulated in pancreatic β-cells of streptozotocin (STZ)-induced diabetic rats, correlating with apoptosis (BAX, Caspase 3, p53 upregulation) .

Parkinson’s Disease (PD)

  • No association found in large-scale genetic studies of Chinese PD cohorts .

Bladder Cancer (BLCA)

  • Identified as part of a risk profile with FBXO6 and OAS1, linked to M1 macrophage pathways (chemokine signaling, antigen presentation) .

Research Applications

Recombinant Protein Uses

ApplicationMethodologySource
Antibody ValidationImmunohistochemistry (IHC-P) using rabbit polyclonal antibodies (Abcam)
Functional StudiesApoptosis assays in diabetic models (qPCR for TMEM229B suppression)
Pathway AnalysisGSEA enrichment (e.g., chemokine signaling in BLCA)

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order notes. We will accommodate your request if possible.
Lead Time
Delivery times may vary based on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type requirement, please communicate it to us, and we will prioritize its development.
Synonyms
TMEM229B; C14orf83; Transmembrane protein 229B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-167
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMEM229B
Target Protein Sequence
MASAEPLTALSRWYLYAIHGYFCEVMFTAAWEFVVNLNWKFPGVTSVWALFIYGTSILIV ERMYLRLRGRCPLLLRCLIYTLWTYLWEFTTGFILRQFNACPWDYSQFDFDFMGLITLEY AVPWFCGALIMEQFIIRNTLRLRFDKDAEPGEPSGALALANGHVKTD
Uniprot No.

Target Background

Database Links

HGNC: 20130

KEGG: hsa:161145

UniGene: Hs.509707

Protein Families
TMEM229 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TMEM229B and what is its genomic location?

TMEM229B (transmembrane protein 229B), also known as C14orf83, is a protein-coding gene located on chromosome 14q24.1. It spans from position 67470269 to 67533850 on the complement strand and consists of 10 exons . The protein is predicted to be located in the membrane and act upstream of or within macrophage activation and response to bacterium pathways . Research indicates its involvement in multiple biological processes, though its exact molecular function remains under investigation.

What species-specific recombinant TMEM229B proteins are available for research?

Recombinant TMEM229B proteins have been developed from multiple species for comparative research purposes. These include proteins derived from human, mouse, chicken, zebrafish, rhesus macaque, bovine, and Mus musculus models . These are typically expressed in various expression systems including mammalian cells (particularly HEK293), and E. coli, with different tag options (His, DDK, Myc, Avi, Fc) to facilitate purification and detection in experimental settings .

What disease associations have been identified for TMEM229B?

Genome-wide association studies (GWAS) have linked TMEM229B to several conditions:

  • Parkinson's disease - TMEM229B was identified as a risk locus in a large meta-analysis GWAS study

  • Circulating phospho- and sphingolipid concentrations - Novel loci including TMEM229B were associated with these biomarkers

  • Childhood obesity in Hispanic populations - Genetic variants of TMEM229B were identified as potentially contributing to childhood obesity pathophysiology

These associations suggest TMEM229B may play roles in neurodegeneration, lipid metabolism, and metabolic regulation.

What are the optimal cell lines and culture conditions for studying TMEM229B expression?

While specific optimal conditions for TMEM229B haven't been definitively established, research with transmembrane proteins in the same family suggests several approaches. HEK293T cells have been successfully used for transfection and expression of TMEM family proteins . These cells can be maintained in DMEM supplemented with 10% fetal calf serum, 1% Na pyruvate, and penicillin/streptomycin at standard culture conditions (37°C, 5% CO₂) .

For studies requiring physiologically relevant expression, induced pluripotent stem cells (iPSCs) can be maintained in E8 Flex media in 5% CO₂, with medium changes every two days and passage using enzyme-free reagents like ReLeSR when appropriate confluency is reached . These systems allow for the study of TMEM229B in contexts that more closely mimic human physiology.

What transfection methods are effective for TMEM229B expression studies?

Based on protocols used for similar transmembrane proteins, effective transfection of TMEM229B constructs can be achieved in HEK293T cells using FuGene HD Transfection Reagent . For gateway expression constructs, cloning strategies include:

  • Purification of the insert (typically 150 ng)

  • Cloning into appropriate vectors (such as C2-GFP vector using infusion Enzyme Mix)

  • Validation by Sanger sequencing

  • For gateway cloning systems, use of pDONR vectors and subsequent transfer to destination vectors like pcDNA3native/DEST using LR Clonase enzyme mix

Detection of expressed protein can be performed using standard western blotting techniques with appropriate primary antibodies against TMEM229B and secondary detection systems.

How can TMEM229B expression be quantified in experimental models?

Quantification of TMEM229B expression can be performed using quantitative reverse transcription PCR (qRT-PCR). The protocol involves:

  • RNA extraction from tissue or cell samples

  • Concentration estimation using spectrophotometry

  • Reverse transcription of 2 μg total RNA into cDNA using appropriate master mixes (e.g., SuperScript VILO)

  • Amplification in duplicate 25 μl reactions with SYBR green

  • Analysis using the ΔΔCt method on qPCR systems such as ABI PRISM 7900HT

For protein-level quantification, western blotting with specific anti-TMEM229B antibodies (such as those available from commercial suppliers) can be used following standard protein separation by PAGE and transfer to nitrocellulose membranes.

How does estradiol affect TMEM229B expression?

Research indicates complex interactions between 17β-estradiol and TMEM229B expression:

InteractionEffectExperimental SystemNotes
17β-estradiol aloneIncreased expressionHuman/rat homologyEstradiol results in increased expression of TMEM229B mRNA
17β-estradiol + TGFB1Decreased expressionHuman/rat homologyCo-treatment with TGFB1 causes decreased expression
17β-estradiol + EGFInhibited reactionHuman/rat homologyEGF protein inhibits the interaction

These findings suggest that TMEM229B expression is estrogen-responsive but modulated by growth factors and cytokines, indicating potential roles in hormone-responsive pathways and possible implications for sex differences in associated conditions.

What environmental compounds are known to modulate TMEM229B expression?

Several environmental compounds have been shown to affect TMEM229B expression:

CompoundEffect on ExpressionExperimental System
2,3,7,8-tetrachlorodibenzodioxineDecreased/Increased*Direct experimental/Mouse homology
2,2',4,4',5,5'-hexachlorobiphenylMultiple interactionsMouse homology
2,2',5,5'-tetrachlorobiphenylMultiple interactionsMouse homology
2,3',4,4',5-PentachlorobiphenylIncreasedMouse homology
3,4-methylenedioxymethamphetamineIncreasedMouse homology
4-hydroxyphenyl retinamideIncreasedMouse homology
6-propyl-2-thiouracilBoth increased and decreased*Direct experimental
AcetamideIncreasedDirect experimental
AcrylamideIncreasedDirect experimental

*Effects vary based on experimental conditions and models

These interactions suggest TMEM229B expression responds to various xenobiotics and environmental toxicants, which may have implications for understanding gene-environment interactions in conditions like Parkinson's disease where TMEM229B is implicated as a risk factor.

What are the methodological approaches for investigating TMEM229B's role in Parkinson's disease pathophysiology?

Given TMEM229B's identification as a risk locus for Parkinson's disease , several methodological approaches can be employed:

  • Next-generation sequencing to identify rare and common variants - Following the approach used in the Chinese PD cohort study

  • Gene-based and allele-based analysis - Separating early-onset and late-onset PD cases for differential genetic contribution assessment

  • Case-control studies with carefully phenotyped cohorts - Ensuring diagnosis according to Movement Disorders Society clinical criteria

  • Functional validation in cellular models - Using both patient-derived cells and genetically modified cell lines

  • Pathway analysis - Investigating TMEM229B's interaction with established PD pathways such as mitochondrial function, alpha-synuclein processing, and neuroinflammation

These approaches require meticulous control for population stratification, particularly in studies across different ethnic groups, as variant frequencies may differ significantly.

How might TMEM229B function in macrophage activation and bacterium response pathways?

TMEM229B is predicted to act upstream of or within macrophage activation and response to bacterium . To investigate this function:

  • Macrophage differentiation models - Utilize monocyte-derived macrophages with TMEM229B knockdown/overexpression

  • Bacterial challenge experiments - Assess phagocytosis efficiency, cytokine production, and bacterial killing with modulated TMEM229B levels

  • Signaling pathway analysis - Examine changes in NF-κB, MAPK, and JAK-STAT pathways with altered TMEM229B expression

  • Co-immunoprecipitation studies - Identify TMEM229B protein interaction partners in macrophages during bacterial challenges

  • Spatial localization during phagocytosis - Track TMEM229B localization during bacterial internalization using fluorescent tagging

Understanding TMEM229B's role in macrophage function could provide insights into both infectious disease responses and neuroinflammation in neurodegenerative conditions like Parkinson's disease.

What techniques can be employed to investigate TMEM229B's membrane topology and functional domains?

As a transmembrane protein, TMEM229B's structure-function relationship requires specialized approaches:

  • Hydrophobicity plot analysis and transmembrane domain prediction using computational tools

  • Epitope tagging at N- and C-termini combined with selective permeabilization immunofluorescence to determine cytoplasmic vs. luminal domains

  • CRISPR/Cas9-mediated domain deletion or mutation to identify functional regions

  • Protease protection assays to determine membrane topology

  • Split-GFP complementation assays to validate predicted topological models

  • Cysteine scanning mutagenesis combined with membrane-impermeable thiol-reactive reagents

These approaches can clarify TMEM229B's orientation in the membrane and identify domains critical for its function in macrophage activation and other cellular processes.

How does TMEM229B research integrate with broader studies of transmembrane protein family functions?

TMEM229B belongs to a large family of transmembrane proteins with diverse functions. Integration approaches include:

  • Comparative analysis with other TMEM family members implicated in Parkinson's disease (TMEM230, TMEM175, TMEM163)

  • Phylogenetic analysis to identify evolutionarily conserved domains across the TMEM family

  • Shared pathway analysis to identify common signaling systems across TMEM proteins

  • Systems biology approaches to map the entire "TMEM interactome" in relevant cell types

  • Meta-analysis of GWAS data to identify disease associations shared among multiple TMEM family members

This integrated approach may reveal functional redundancies or synergies among TMEM family proteins that could explain partial penetrance of genetic variants in disease states.

What are the most promising translational applications of TMEM229B research?

Based on current knowledge of TMEM229B associations, several translational directions show promise:

  • Biomarker development for Parkinson's disease risk stratification - Using TMEM229B variants in polygenic risk scores

  • Drug target exploration - If TMEM229B modulation affects macrophage-mediated neuroinflammation in PD models

  • Genetic testing panels - Inclusion of TMEM229B in comprehensive panels for PD risk assessment

  • Therapeutic development targeting lipid metabolism - Given TMEM229B's association with phospho- and sphingolipid concentrations

  • Personalized medicine approaches - Tailoring treatments based on TMEM229B variant status in obesity and PD

These translational directions require further validation of TMEM229B's functional roles and confirmation of causality rather than mere association with disease states.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.