Recombinant Human Transmembrane protein 233 (TMEM233)

Shipped with Ice Packs
In Stock

Description

Introduction to TMEM233

TMEM233 (Transmembrane Protein 233), also known as DSPB2 (Dispanin Subfamily B Member 2), belongs to the dispanin family of transmembrane proteins. Initially identified through its interaction with voltage-gated sodium (NaV) channels, TMEM233 plays a critical role in neuronal signaling, particularly in nociceptors (pain-sensing neurons). Its discovery as an essential accessory protein for the activity of pain-causing toxins, such as excelsatoxin A (ExTxA) from the Australian stinging tree Dendrocnide excelsa, has positioned it as a key target in pain research .

Functional Role in NaV Channel Modulation

TMEM233 modulates NaV1.7 gating properties when co-expressed with the channel:

  • Hyperpolarizing shift in activation voltage dependence (−11.6 mV)

  • Depolarizing shift in fast inactivation voltage dependence (+18.0 mV)

  • Reduced recovery time from inactivation .
    These effects amplify neuronal excitability, enabling ExTxA to induce persistent NaV currents and Ca²⁺ influx, leading to pain signaling .

Mechanism of ExTxA-Induced Pain

ExTxA, a plant-derived knottin peptide, binds extracellularly to TMEM233, not directly to NaV1.7. This interaction:

  1. Prevents fast inactivation of NaV1.7 currents, prolonging depolarization.

  2. Triggers Ca²⁺ influx in DRG neurons, activating nocifensive behaviors (e.g., paw withdrawal) .

ExperimentOutcome
CRISPR Knockdown (TE-671 cells)Loss of ExTxA sensitivity; TMEM233 identified as critical mediator .
TMEM233 Knockout MiceReduced ExTxA-induced Ca²⁺ influx and pain responses .
Co-Expression in HEK293 CellsRecapitulates ExTxA’s effects on NaV1.7 gating (EC₅₀ ≈ 80.9 nM) .

Experimental Evidence

  • Binding Studies: Biotin-ExTxA labels TMEM233-expressing cells but not NaV1.7 alone, confirming direct interaction .

  • Topology Validation: Immunofluorescence and flow cytometry confirm extracellular C-terminus .

Production and Use

Recombinant TMEM233 is typically expressed in heterologous systems (e.g., HEK293 cells) for functional studies. Key features include:

  • Tags: N-terminal or C-terminal tags (e.g., HA, Alexa488) for tracking .

  • Purity: >85% as determined by SDS-PAGE .

  • Applications:

    • Toxin Screening: Identifying NaV channel modulators.

    • Pain Mechanism Studies: Elucidating TMEM233-NaV1.7 interactions.

ParameterDetails
Host SystemHEK293, TE-671, or mouse DRG neurons
TagsHA, Alexa488, or biotin for tracking
Molecular Weight~12 kDa (mouse recombinant)
Functional AssaysFluorescence membrane potential assays, electrophysiology

Challenges and Limitations

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have any specific requirements for the format, please indicate them in your order remarks. We will then prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize development of that specific tag.
Synonyms
TMEM233; IFITMD2; Transmembrane protein 233; Dispanin subfamily B member 2; DSPB2; Interferon-induced transmembrane domain-containing protein D2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMEM233
Target Protein Sequence
MSQYAPSPDFKRALDSSPEANTEDDKTEEDVPMPKNYLWLTIVSCFCPAYPINIVALVFS IMSLNSYNDGDYEGARRLGRNAKWVAIASIIIGLLIIGISCAVHFTRNA
Uniprot No.

Target Background

Gene References Into Functions
  1. Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator) PMID: 20379614
Database Links

HGNC: 37219

KEGG: hsa:387890

STRING: 9606.ENSP00000403130

UniGene: Hs.530965

Protein Families
CD225/Dispanin family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TMEM233 and what is its basic structure?

TMEM233 (Transmembrane Protein 233) is a member of the dispanin family of transmembrane proteins expressed in sensory neurons. It is predicted to be an integral component of the membrane with active functions within the membrane environment . The protein has alternative names including DSPB2 and IFITMD2, suggesting multiple roles or historical classification changes in scientific literature . The human TMEM233 gene is approximately 60522 bp in length and encodes a protein with a molecular weight of approximately 12.07 kDa . The protein is characterized by its transmembrane domains that anchor it within cellular membranes, positioning it to interact with other membrane proteins such as voltage-gated sodium channels.

What cellular functions has TMEM233 been associated with?

TMEM233 has been identified as a previously unknown NaV1.7-interacting protein that is essential for the pharmacological activity of certain toxins at NaV channels . Research has demonstrated that co-expression of TMEM233 modulates the gating properties of NaV1.7, suggesting a regulatory role in neuronal excitability . This finding positions TMEM233 and other dispanins as accessory proteins that are indispensable for toxin-mediated effects on NaV channel gating, providing important insights into the function of NaV channels in sensory neurons . The interaction with NaV1.7 specifically links TMEM233 to pain signaling pathways, as NaV1.7 is a critical regulator of neuronal excitability in nociceptors and important pain target .

How is TMEM233 expressed in different tissues?

While the search results don't provide comprehensive tissue expression data for TMEM233, they indicate that it is expressed in sensory neurons . This localization is consistent with its functional role in modulating NaV1.7 channels, which are predominantly expressed in peripheral sensory neurons involved in pain sensation. For researchers interested in expression patterns, techniques such as RNA sequencing, quantitative PCR, or immunohistochemistry would be appropriate to characterize TMEM233 expression across various tissues. The database referenced in search result appears to have tissue-specific RNA expression data capabilities, though specific data wasn't provided in the excerpt.

What are effective strategies for recombinant expression of TMEM233?

Based on successful approaches for expressing other transmembrane proteins, researchers can consider several strategies for TMEM233 expression. While the search results don't provide TMEM233-specific expression protocols, they offer insights from related transmembrane protein expression methods. For example, researchers successfully expressed and purified a seven-transmembrane protein using E. coli expression systems . For TMEM233 expression, similar approaches could be adapted:

  • Vector selection: pET15b or pDEST15 vectors can be used with appropriate tags (e.g., 6×His-tag or GST-tag) for purification .

  • Codon optimization: The gene sequence should be codon-optimized for the expression system to enhance protein yield .

  • Expression conditions: Testing various conditions is crucial, including:

    • Temperature variations (18-20°C for extended periods or 37°C for shorter periods)

    • Different induction methods (e.g., 1mM IPTG or 0.2% L-arabinose depending on the vector system)

    • Culture media options (LB media or M9 media)

  • Induction protocols: For optimal expression, cultures should be grown to appropriate density (OD600 = 0.4-0.9) before induction, followed by continued incubation with shaking (e.g., 220 rpm) for 2-18 hours depending on temperature .

What purification methods are recommended for recombinant TMEM233?

For transmembrane proteins like TMEM233, purification typically requires specialized approaches due to their hydrophobic nature. Based on successful methods for other transmembrane proteins, researchers could consider:

  • Affinity chromatography: Using tags such as 6×His-tag or GST-tag for initial capture, followed by tag cleavage if necessary for functional studies .

  • Membrane solubilization: Careful selection of detergents is critical for extracting membrane proteins without denaturation.

  • Size exclusion chromatography: For further purification and to ensure proper folding and homogeneity.

  • Quality assessment: SDS-PAGE analysis followed by Western blotting with anti-tag antibodies (e.g., anti-6×His tag) to confirm protein identity and purity .

  • Mass spectrometry: LC-MS/MS analysis can provide definitive identification and characterize potential post-translational modifications .

The purification protocol should be optimized based on the specific properties of TMEM233 and the intended downstream applications.

How can researchers verify the functional activity of recombinant TMEM233?

Verifying the functional activity of recombinant TMEM233 requires assays that assess its known biological functions. Based on the research findings, appropriate functional validation methods could include:

  • Electrophysiological assays: Since TMEM233 modulates NaV1.7 gating properties, patch-clamp recordings in expression systems co-expressing TMEM233 and NaV1.7 would be valuable to measure changes in channel kinetics and voltage dependence .

  • Toxin-response assays: As TMEM233 is essential for the pharmacological activity of ExTxA at NaV channels, assays measuring ExTxA effects in the presence and absence of TMEM233 could confirm functionality .

  • Protein-protein interaction studies: Co-immunoprecipitation or proximity ligation assays to confirm interaction with NaV1.7 and potentially identify other interaction partners.

  • Cellular localization: Immunofluorescence or subcellular fractionation to verify proper membrane localization, which is essential for function.

These functional assays should be designed to specifically assess the known roles of TMEM233 in modulating NaV channel function and mediating toxin effects.

How does TMEM233 contribute to pain signaling mechanisms?

TMEM233 contributes to pain signaling primarily through its interaction with voltage-gated sodium channels, particularly NaV1.7, which are critical regulators of neuronal excitability in sensory neurons . Research has shown that:

  • TMEM233 modulates the gating properties of NaV1.7 when co-expressed, potentially affecting the threshold and frequency of action potential firing in nociceptors .

  • TMEM233 is essential for the pharmacological activity of ExTxA, a pain-causing knottin peptide from the Australian stinging tree Dendrocnide excelsa . This suggests TMEM233 plays a role in toxin-induced pain mechanisms.

  • As NaV1.7 is predominantly expressed in peripheral sensory neurons and is a key contributor to pain perception, TMEM233's interaction with this channel positions it as a potential regulator of pain sensitivity .

  • The identification of TMEM233 as a NaV1.7-interacting protein provides new insights into the complex regulation of sensory neuron excitability and pain signaling pathways .

Understanding these mechanisms could potentially lead to novel therapeutic approaches for pain management by targeting TMEM233-NaV1.7 interactions.

What is the relationship between TMEM233 and stinging nettle toxins?

The relationship between TMEM233 and stinging nettle toxins, particularly Excelsatoxin A (ExTxA), represents a significant discovery in understanding plant toxin mechanisms. Research has revealed:

  • ExTxA is a pain-causing knottin peptide from the Australian stinging tree Dendrocnide excelsa and is the first reported plant-derived NaV channel modulating peptide toxin .

  • TMEM233 is essential for the pharmacological activity of ExTxA at NaV channels, providing a novel mechanism by which plant toxins can induce pain .

  • Unlike many toxins that directly interact with the pore-forming α subunit of NaV channels (typically via extracellular loops of the voltage-sensing domains or pore domain residues), ExTxA requires TMEM233 to exert its effects .

  • This finding positions TMEM233 as an accessory protein that is indispensable for toxin-mediated effects on NaV channel gating, revealing a previously unknown mechanism of toxin action .

This relationship provides valuable insights into both the molecular mechanisms of plant toxin-induced pain and the functional significance of TMEM233 in sensory neurons.

What experimental models are most appropriate for studying TMEM233 function in pain pathways?

Based on the research findings, several experimental models would be appropriate for studying TMEM233 function in pain pathways:

  • Heterologous expression systems:

    • Cell lines (HEK293, CHO) co-expressing TMEM233 and NaV1.7 for electrophysiological studies of channel gating properties

    • These systems allow for controlled manipulation of expression levels and pharmacological interventions

  • Primary sensory neuron cultures:

    • Isolated dorsal root ganglion (DRG) neurons that naturally express both TMEM233 and NaV1.7

    • Genetic manipulation (knockdown/overexpression) to assess the impact on neuronal excitability and toxin responses

  • In vivo models:

    • Transgenic mice with TMEM233 modifications to study behavioral responses to pain stimuli

    • Models using toxin application (such as ExTxA) to evaluate the role of TMEM233 in toxin-induced pain

  • Molecular interaction studies:

    • Structural biology approaches to characterize TMEM233-NaV1.7 interactions

    • FRET/BRET assays to monitor protein interactions in living cells

These models, used in combination, would provide comprehensive insights into the functional role of TMEM233 in pain signaling pathways.

How does TMEM233 structurally interact with NaV1.7 and other ion channels?

Understanding the structural interaction between TMEM233 and NaV1.7 represents an important frontier in research. While the search results don't provide detailed structural information, several methodological approaches can address this question:

  • Structural biology techniques:

    • Cryo-electron microscopy of TMEM233-NaV1.7 complexes

    • X-ray crystallography of purified components or interacting domains

    • Nuclear magnetic resonance (NMR) for analyzing specific binding interfaces

  • Computational modeling:

    • Similar to the AlphaFold2 approach mentioned for other transmembrane proteins , computational models of TMEM233 could be developed

    • Molecular docking simulations to predict interaction interfaces

    • Molecular dynamics simulations to understand the dynamic nature of these interactions

  • Mutagenesis studies:

    • Systematic mutation of residues in both TMEM233 and NaV1.7 to identify critical interaction points

    • Electrophysiological characterization of mutants to correlate structural changes with functional effects

  • Protein-protein interaction mapping:

    • Cross-linking mass spectrometry to identify proximity relationships

    • Hydrogen-deuterium exchange mass spectrometry to identify binding interfaces

    • FRET/BRET approaches with fluorescently labeled proteins to monitor interactions in live cells

These approaches would help elucidate how TMEM233 structurally interacts with NaV1.7 and potentially with other ion channels in sensory neurons.

What is the evolutionary significance of TMEM233 across species?

The evolutionary history of TMEM233 across species could provide insights into its conserved functions and specialized adaptations. Although the search results don't directly address this question, several methodological approaches could be employed:

  • Phylogenetic analysis:

    • Comparative genomics to identify TMEM233 homologs across species

    • Construction of phylogenetic trees to understand evolutionary relationships

    • Analysis of selection pressures (dN/dS ratios) to identify functionally important regions

  • Functional conservation studies:

    • Expression of TMEM233 orthologs from different species in mammalian systems

    • Assessment of their ability to modulate NaV channel function

    • Evaluation of toxin sensitivity across species with different TMEM233 variants

  • Structural comparison:

    • Analysis of conserved domains and motifs across species

    • Identification of species-specific structural features that might correlate with functional differences

    • 3D structure prediction and comparison across species

  • Co-evolution analysis:

    • Investigation of co-evolution between TMEM233 and NaV channels across species

    • Analysis of co-adaptation between TMEM233 and toxin sensitivity

Understanding the evolutionary context of TMEM233 could reveal why certain species might be more or less sensitive to particular toxins and provide insights into the protein's fundamental biological roles.

What potential therapeutic applications could target TMEM233-NaV1.7 interactions?

The discovery of TMEM233 as a critical modulator of NaV1.7 function opens new possibilities for therapeutic interventions in pain management. Several methodological approaches to explore therapeutic applications include:

  • High-throughput screening:

    • Development of assays to identify small molecules that modulate TMEM233-NaV1.7 interactions

    • Screening for compounds that either enhance or disrupt this interaction depending on the desired effect

  • Peptide-based therapeutics:

    • Design of peptides that mimic interaction interfaces to competitively inhibit TMEM233-NaV1.7 binding

    • Development of stapled peptides or other stabilized peptide mimetics for improved pharmacokinetics

  • Antibody therapeutics:

    • Generation of antibodies that specifically target the TMEM233-NaV1.7 interaction interface

    • Development of single-domain antibodies or nanobodies for better tissue penetration

  • Gene therapy approaches:

    • CRISPR-based modulation of TMEM233 expression in specific neuronal populations

    • Viral vector delivery of modified TMEM233 variants with altered NaV1.7 interaction properties

  • Toxin-derived therapeutics:

    • Structure-function analysis of ExTxA to develop modified toxins with analgesic rather than algesic properties

    • Exploitation of the TMEM233-dependent mechanism for targeted delivery of therapeutic agents

These approaches could potentially lead to novel pain therapeutics with improved specificity compared to current sodium channel blockers, which often have significant side effects due to their broad activity across multiple sodium channel subtypes.

What are the main challenges in expressing and purifying functional TMEM233?

Expressing and purifying functional transmembrane proteins like TMEM233 presents several technical challenges. Based on experiences with similar proteins, researchers might encounter:

  • Expression yield challenges:

    • Transmembrane proteins often express at lower levels than soluble proteins

    • Optimization of expression conditions (temperature, induction time, media composition) is critical

    • Testing multiple expression systems (bacterial, yeast, insect, mammalian) may be necessary to identify optimal conditions

  • Protein folding and stability issues:

    • Ensuring proper membrane insertion and folding during expression

    • Maintaining native conformation during solubilization and purification

    • Preventing aggregation of hydrophobic transmembrane domains

  • Detergent selection complexity:

    • Identifying detergents that effectively solubilize TMEM233 without denaturing it

    • Balancing extraction efficiency with preservation of protein-protein interactions

    • Considering alternative solubilization methods such as nanodiscs or amphipols

  • Functional verification difficulties:

    • Developing assays to confirm that purified TMEM233 retains its native function

    • Reconstituting functional interactions with NaV1.7 in artificial membrane systems

    • Quantifying binding affinities and kinetics in detergent-solubilized state

Addressing these challenges requires systematic optimization and potentially the development of novel approaches specific to TMEM233.

How can researchers effectively study TMEM233-toxin interactions?

Studying the interactions between TMEM233 and toxins like ExTxA requires specialized methodological approaches:

  • Binding assays:

    • Surface plasmon resonance (SPR) to measure binding kinetics between purified TMEM233 and toxins

    • Fluorescence-based binding assays using labeled toxins

    • Isothermal titration calorimetry (ITC) to determine thermodynamic parameters of binding

  • Functional assays:

    • Electrophysiological recordings in expression systems containing TMEM233 and NaV1.7 to measure toxin effects

    • Calcium imaging in sensory neurons to assess the impact of toxins on cellular excitability

    • Competitive binding assays to identify binding sites and potential inhibitors

  • Structural approaches:

    • Co-crystallization or cryo-EM of TMEM233-toxin complexes

    • NMR studies of labeled toxins binding to TMEM233

    • Computational docking and molecular dynamics simulations

  • Cell-based systems:

    • Development of reporter cell lines expressing TMEM233 and NaV1.7 with fluorescent readouts for toxin activity

    • CRISPR-engineered sensory neurons with modified TMEM233 to study toxin response variations

These methodological approaches would help elucidate the mechanism by which TMEM233 facilitates toxin effects on NaV channels and potentially identify ways to modulate these interactions.

What knockdown or knockout strategies are most effective for studying TMEM233 function?

Several genetic manipulation approaches could be effective for studying TMEM233 function:

  • CRISPR-Cas9 genome editing:

    • Generation of complete knockout cell lines or animal models

    • Creation of conditional knockout models to study tissue-specific effects

    • Introduction of specific mutations to study structure-function relationships

  • RNA interference approaches:

    • siRNA for transient knockdown in cell culture models

    • shRNA for stable knockdown in long-term experiments

    • Antisense oligonucleotides for in vivo knockdown in specific tissues

  • Dominant-negative approaches:

    • Expression of truncated or mutated TMEM233 variants that interfere with native protein function

    • Particularly useful for studying multi-protein complexes

  • Rescue experiments:

    • Reintroduction of wild-type or mutant TMEM233 into knockout backgrounds

    • Critical for confirming specificity of observed phenotypes and structure-function analyses

  • Temporal control strategies:

    • Inducible expression or knockdown systems to study acute versus chronic effects

    • Particularly valuable for distinguishing developmental versus functional roles

The choice of strategy would depend on the specific research question, model system, and available resources, with CRISPR-based approaches offering the highest specificity for genetic manipulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.