Recombinant Human Transmembrane protein 234 (TMEM234)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Classification

TMEM234 is predicted to be an integral membrane protein with transmembrane domains consistent with solute carrier (SLC)-like proteins. Key structural features include:

  • Transmembrane helices: Likely involves multiple α-helical domains, characteristic of SLC transporters .

  • Ortholog conservation: Shares homology with TMEM234 proteins in mammals (e.g., bovine, rat, zebrafish) and non-mammalian species (e.g., green monkey, naked mole-rat) .

FeatureDescriptionSource
Gene ID (Human)56063, 76799, 682404, 708043, 611851, 101081483, 100126052, 100070307
UniProt AccessionQ8WY98 (Human), A7YW81 (Bovine)
Predicted LocalizationPodocyte foot processes (kidney), basal plasma membrane domain
Pfam/InterPro FamiliesUPF0546 (unknown function), linked to multidrug resistance efflux transporters

Role in Podocyte Integrity

Knockdown studies in zebrafish larvae revealed TMEM234’s critical role in maintaining the glomerular filtration barrier:

  • Podocyte dysfunction: Knockdown caused foot process effacement, reduced podocyte cell count, and proteinuria (leakage of 500-kDa dextran into tubules) .

  • Rescue experiments: Mouse TMEM234 mRNA partially restored podocyte GFP expression, confirming functional conservation between species .

ExperimentObservationMethod
TMEM234 knockdown (Zebrafish)42% podocyte GFP expression vs. 93% in controls; foot process effacementFluorescence imaging
Filtration assay500-kDa dextran leakage into tubules (absent in controls)FITC/Rhodamine dextran
Cross-species rescuePartial restoration of GFP expression with mouse TMEM234 mRNAqPCR, fluorescence

Hypothesized Mechanisms

  • SLC-like transporter: Though unconfirmed, structural similarities suggest potential solute transport roles .

  • Adhesion factor: May interact with the glomerular basement membrane (GBM) to stabilize podocyte structures .

Recombinant Production and Applications

Recombinant TMEM234 proteins are primarily used for biological assays and drug discovery. While human-specific data is sparse, non-human recombinant variants (e.g., bovine) provide structural and functional templates:

ParameterBovine TMEM234 (E. coli) Human TMEM234 (Mammalian)
LengthFull-length (1–140 aa)Full-length (not specified)
TagN-terminal His tagNative (no tag specified)
Purity>90% (SDS-PAGE)Not reported
ApplicationsSDS-PAGE, functional assaysCell culture, ELISA, PK/PD models
Storage-20°C/-80°C (lyophilized)Not specified

Challenges and Future Directions

  • Human-specific data gaps: Most studies rely on orthologs; direct human TMEM234 functional studies are needed.

  • Transporter role ambiguity: Despite SLC-like domains, substrate specificity and transport mechanism remain uncharacterized .

  • Therapeutic potential: Proteinuria phenotypes suggest TMEM234 as a candidate for kidney disease therapies, but further validation is required .

Key References and Sources

  1. Rat Genome Database : Ortholog data and gene annotations.

  2. Biorxiv : SLC-like protein classification and structural analysis.

  3. Creative Biomart : Bovine recombinant TMEM234 specifications.

  4. Genemedi : Human TMEM234 production platforms and disease associations.

  5. AJP-Renal Physiology : Zebrafish podocyte studies and filtration assays.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
TMEM234; C1orf91; PP1065; UNQ548/PRO1105; Transmembrane protein 234
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-164
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMEM234
Target Protein Sequence
MAASLGQVLALVLVAALWGGTQPLLKRASAGLQRVHEPTWAQQLLQEMKTLFLNTEYLMP FLLNQCGSLLYYLTLASTDLTLAVPICNSLAIIFTLIVGKALGEDIGGKRAVAGMVLTVI GISLCITSSVPWTAELQLHGKGQLQTLSQKCKREASGTQSERFG
Uniprot No.

Target Background

Database Links

HGNC: 28837

KEGG: hsa:56063

UniGene: Hs.272299

Protein Families
TMEM234 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TMEM234 and where is it located in the genome?

TMEM234 (transmembrane protein 234) is a protein-coding gene located on chromosome 1p35.2 in humans . The gene spans approximately 7.9 kb on the complement strand (NC_000001.11, positions 32214477-32222353) and contains 12 exons . It is also known by several alternative designations including AASL548, C1orf91, PRO1105, RP4-622L5, and dJ622L5.7 .

What is the predicted structure and cellular localization of TMEM234?

TMEM234 is predicted to be an integral component of the cell membrane . Structurally, it is thought to have a hairpin conformation with both C- and N-terminal regions extending toward the extracellular space . The protein belongs to the TCDB #2.A.7.32 family and contains a corresponding "TMEM234" Pfam domain . In podocytes specifically, TMEM234 appears to be localized to the basal plasma membrane domain, potentially at the foot processes, but not between cells where developing slit diaphragms are found .

What are the available tools and resources for TMEM234 research?

Multiple resources exist for TMEM234 research:

  • NCBI Gene and GTR (Genetic Testing Registry) provide genomic context and clinical information

  • COSMIC database contains information about somatic mutations in TMEM234 related to cancer

  • ZFIN database offers data on the zebrafish ortholog (tmem234)

  • Commercial resources like recombinant proteins are available for experimental use

For functional studies, researchers have successfully used zebrafish morpholino knockdown approaches and recombinant protein expression systems .

What is known about the tissue expression pattern of TMEM234?

TMEM234 shows highly enriched expression in kidney podocytes as demonstrated by both RT-PCR and immunofluorescence analyses . In studies of human kidney sections, strong glomerular immunoreactivity has been observed, with only weak signals detected in the rest of the kidney . Double-labeling experiments with nephrin (a foot process marker) showed overlapping reactivity for TMEM234, confirming its localization to podocyte foot processes . The protein does not appear to be significantly expressed in mesangial or glomerular endothelial cells, as determined by double staining experiments with CD31 and SMA markers .

What are the known or predicted functions of TMEM234?

TMEM234 has been shown to act upstream of or within glomerular filtration and pronephric glomerulus development . Functional studies in zebrafish demonstrate that TMEM234 is essential for maintaining the integrity of the glomerular filtration barrier . The specific molecular mechanisms remain to be fully elucidated, but based on its localization and knockout phenotypes, TMEM234 may be involved in podocyte-GBM (glomerular basement membrane) adhesion . This hypothesis is supported by the observation that impairment of podocyte-GBM adhesion via integrins results in foot process effacement and proteinuria, similar to the phenotype observed in Tmem234 morphant zebrafish .

How evolutionarily conserved is TMEM234 across species?

TMEM234 shows considerable evolutionary conservation. The protein sequence identity between zebrafish and human TMEM234 proteins is 52%, indicating functional conservation . This conservation is further supported by cross-species rescue experiments where mouse Tmem234 mRNA was able to partially rescue the phenotype caused by knockdown of zebrafish tmem234, validating the orthology between mouse and zebrafish TMEM234 . The zebrafish ortholog (tmem234) is located on chromosome 13 and shares functional characteristics with its human counterpart .

How can zebrafish be used as a model for studying TMEM234 function?

Zebrafish provide an excellent in vivo model for studying TMEM234 function for several reasons:

  • The zebrafish ortholog of TMEM234 (tmem234) shares 52% protein sequence identity with human TMEM234

  • Researchers can use transgenic fish lines expressing GFP under the podocin promoter to visualize podocytes

  • Morpholino-mediated knockdown techniques are well-established:

    • Two different morpholinos targeting different parts of the tmem234 gene (I1E2 and E1I1) have been validated

    • Controls including p53 co-injection and rescue with mouse Tmem234 mRNA have confirmed phenotype specificity

  • Functional assays such as dextran filtration tests allow assessment of glomerular barrier integrity

When using this model, researchers should note that tmem234 morphants exhibit decreased podocyte GFP expression, glomerular disorganization, foot process effacement, and leakage of high molecular weight dextran (500 kDa) into the pronephric tubules .

What methodologies are recommended for studying TMEM234 localization in tissues?

For studying TMEM234 localization in tissues, the following methodologies have proven effective:

  • Immunofluorescence on tissue sections:

    • Double labeling with nephrin (foot process marker) shows overlapping reactivity

    • Double staining with vimentin (major process marker) shows limited colocalization

    • Use CD31 (endothelial marker) and SMA (smooth muscle actin) as negative controls

  • RT-PCR and qPCR for expression analysis:

    • Specific qPCR primer sequences for Tmem234:
      Forward: 5′-GTGCCTGTGGTCAACTCCCT-′3
      Reverse: 5′-AATGCCGTGCGTCTCAGAGA-′3

    • Use nephrin as a control for glomerular fraction purity

    • Use GAPDH/B-actin as loading controls

  • Electron microscopy for ultrastructural localization:

    • While effective for visualizing foot process effacement in knockdown models, current antibodies for TMEM234 have not provided reliable results in immune-electron microscopy

What are the considerations when using recombinant TMEM234 protein for research?

When working with recombinant TMEM234 protein:

  • Expression systems:

    • E. coli-derived recombinant proteins are commercially available with N-terminal His6-ABP tags

    • Mammalian cell line expression systems can be used for producing reference therapeutic antibodies

  • Purification methods:

    • IMAC (immobilized metal affinity chromatography) is suitable for His-tagged versions

    • Typical purification yields concentrations greater than 0.5 mg/ml

  • Storage and handling:

    • Store at -20°C and avoid freeze-thaw cycles

    • Typically supplied in PBS with 1M Urea at pH 7.4

  • Applications:

    • Useful for antibody competition assays

    • Can serve as blocking peptides to confirm antibody specificity

    • Valuable for developing ELISA or other affinity binding assays

How does TMEM234 contribute to glomerular filtration barrier function and what are the molecular mechanisms involved?

TMEM234 plays a critical role in glomerular filtration barrier function, though the exact molecular mechanisms remain to be fully characterized. Current research indicates:

  • Loss of function consequences:

    • Knockdown of Tmem234 in zebrafish leads to compromised glomerular filtration barrier integrity

    • Specifically, ultrastructural analysis reveals foot process effacement in morphant pronephric glomeruli

    • Functionally, this manifests as leakage of high molecular weight (500 kDa) dextran into the tubules, which is not observed in wild-type zebrafish

  • Possible molecular mechanisms:

    • Based on its localization to the basal aspects of podocytes (not between cells where developing slit diaphragms are found), TMEM234 may be involved in podocyte-GBM adhesion

    • This hypothesis is supported by the similarity between phenotypes resulting from impaired podocyte-GBM adhesion via integrins and those observed in Tmem234 morphants

    • TMEM234 could potentially interact with or modulate integrin-mediated adhesion pathways, though direct evidence for this is currently lacking

  • Research gaps and future directions:

    • Identification of binding partners and interacting proteins

    • Characterization of signaling pathways affected by TMEM234 disruption

    • Investigation of potential role in cytoskeletal organization that maintains podocyte foot process structure

What is known about TMEM234 mutations in human disease, particularly in relation to kidney disorders?

Research on TMEM234 mutations in human disease is still in its nascent stages. Current knowledge includes:

How can proteomics and interactome studies enhance our understanding of TMEM234 function?

Proteomic and interactome approaches offer powerful strategies to elucidate TMEM234 function:

  • Potential methodologies:

    • Proximity labeling techniques (BioID, APEX) to identify proteins in close spatial proximity to TMEM234 in podocytes

    • Co-immunoprecipitation followed by mass spectrometry to identify direct binding partners

    • Yeast two-hybrid screening to identify protein-protein interactions

    • Cross-linking mass spectrometry to capture transient interactions

  • Research questions addressable through these approaches:

    • Identification of the TMEM234 interactome in podocytes

    • Determination whether TMEM234 functions within known adhesion complexes or forms novel complexes

    • Investigation of potential interactions with integrin-associated proteins or cytoskeletal components

    • Examination of how TMEM234 interactions change during podocyte injury or disease states

  • Technical considerations:

    • Requirement for validated antibodies or appropriately tagged TMEM234 constructs

    • Need for podocyte-specific approaches given the cell-type specific expression pattern

    • Importance of comparing interactomes across different developmental stages and disease conditions

What is the potential relevance of TMEM234 in kidney disease diagnostics and therapeutics?

TMEM234's highly specific expression in podocytes and its essential role in glomerular barrier function suggest several translational applications:

  • Diagnostic potential:

    • TMEM234 could serve as a biomarker for podocyte injury or loss in kidney diseases

    • Changes in urinary or circulating TMEM234 levels might correlate with disease progression

    • Genetic screening for TMEM234 mutations could help identify causes of unexplained proteinuria

  • Therapeutic implications:

    • TMEM234 represents a potential therapeutic target for preserving podocyte function in proteinuric kidney diseases

    • Approaches might include:

      • Small molecules that enhance TMEM234 stability or function

      • Gene therapy to restore normal TMEM234 expression

      • Cell-based therapies delivering functional TMEM234 to injured podocytes

  • Current limitations:

    • Need for better understanding of the precise molecular mechanisms of TMEM234 function

    • Limited knowledge of TMEM234 regulation under normal and pathological conditions

    • Technical challenges in specifically targeting podocytes in vivo

What experimental approaches can be used to validate TMEM234 as a drug target?

Validating TMEM234 as a potential drug target requires a systematic approach:

  • Target validation strategies:

    • Conditional knockout models to assess effects of TMEM234 deletion at different time points

    • Inducible expression systems to determine if TMEM234 restoration can reverse established pathology

    • CRISPR-based screening to identify synthetic lethal interactions with TMEM234 disruption

  • Assay development for drug screening:

    • Cell-based assays measuring podocyte adhesion strength as a functional readout

    • High-content imaging to assess podocyte morphology and foot process formation

    • Barrier function assays using podocyte monolayers to measure albumin leakage

  • Structure-based approaches:

    • Determination of TMEM234 protein structure through X-ray crystallography or cryo-EM

    • In silico modeling to identify potential binding pockets for small molecules

    • Fragment-based screening to identify chemical scaffolds with binding potential

  • Validation in disease models:

    • Testing promising compounds in zebrafish tmem234 morphants to assess rescue of phenotype

    • Evaluation in rodent models of proteinuric kidney disease

    • Assessment of efficacy in human podocytes derived from patients with kidney disease

What are the technical challenges in producing functional recombinant TMEM234 for structural and functional studies?

Production of functional recombinant TMEM234 presents several technical challenges:

  • Expression system considerations:

    • As a membrane protein, TMEM234 may require mammalian or insect cell expression systems rather than bacterial systems for proper folding and post-translational modifications

    • Current E. coli-derived recombinant proteins may be suitable for antibody production but might not retain native conformation

    • Mammalian cell line expression systems have been used successfully for antibody production

  • Purification challenges:

    • Membrane proteins typically require detergent-based extraction methods

    • Selection of appropriate detergents or lipid nanodiscs to maintain protein stability

    • Need for specialized chromatography approaches beyond standard IMAC purification

  • Construct design strategies:

    • Truncation constructs focusing on specific domains may improve expression yields

    • Addition of solubility-enhancing tags beyond standard His6-tags

    • Fusion with crystallization chaperones for structural studies

  • Functional validation methods:

    • Development of binding assays to confirm interaction with identified partners

    • Reconstitution into liposomes or nanodiscs to assess membrane integration

    • Functional assays to confirm that recombinant protein mimics native activity

PropertyDetails for TMEM234 Recombinant Protein
Molecular Weight24kDa
Expression SystemE. coli
Purification MethodIMAC chromatography
TagN-terminal His6-ABP
Buffer CompositionPBS and 1M Urea, pH 7.4
Concentration0.5mg/mL
Storage-20°C, avoid freeze-thaw cycles
Purity>80%
ApplicationsAntibody Competition, Blocking/Neutralizing, Control

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.