Recombinant Human Transmembrane protein 242 (TMEM242)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Transmembrane Protein 242 (TMEM242)

Transmembrane Protein 242 (TMEM242) is a protein-coding gene in humans . TMEM242 is involved in the assembly of mitochondrial ATP synthase . TMEM242, like other transmembrane proteins (TMEMs), is embedded in cell membranes, and its functions are not completely understood .

Gene Information

The human TMEM242 gene, also known as transmembrane protein 242, is identified by Gene ID: 729515 . The TMEM242 gene is located on chromosome 19 and encodes a protein that is part of the transmembrane protein family .

Function and Role

TMEM242 functions as a scaffold protein involved in the c-ring assembly of mitochondrial ATP synthase (F1F0 ATP synthase or complex V) . TMEM242 may modulate reactive oxygen species (ROS) . Research indicates that a deficiency in TMEM242 can increase ROS levels and enhance coagulation factor levels, potentially leading to disseminated intravascular coagulation (DIC) followed by bleeding .

Research Findings

  • Zebrafish Studies Studies involving zebrafish have provided insights into the role of TMEM242 in hemostasis and coagulation. Knockdown of tmem242 in zebrafish resulted in increased bleeding, suggesting its involvement in hemostasis . Although thrombocyte production and aggregation remained unaffected, coagulation was impaired, leading to delayed fibrin and thrombus formation .

  • Impact on Coagulation Factors The mRNA levels of several clotting factor genes, such as coagulation factor 5 (f5), coagulation factor 7 (f7), and coagulation factor 9a (f9a), were elevated, except for coagulation factor 8 (f8), after tmem242 knockdown . This upregulation of coagulation factors, paradoxically, led to a bleeding phenotype, possibly due to the sequestration of these factors in microthrombi, resembling conditions seen in disseminated intravascular coagulation (DIC) .

  • Role in ROS Regulation TMEM242 appears to play a crucial role in modulating ROS levels. Studies have shown that tmem242 knockdown increases ROS levels, potentially due to impaired ATP synthase assembly . Elevated ROS levels can upregulate sirt6 and nrf2 transcripts, further influencing the expression of coagulation factors .

  • Relationship to Disease TMEM242 is associated with Pierpont Syndrome and Leigh Disease .

TMEM242 and Apoptosis

While the primary focus of the provided research is on TMEM242's role in hemostasis and ROS regulation, it's worth noting that other transmembrane proteins, such as TMEM214, have been implicated in endoplasmic reticulum (ER) stress-induced apoptosis . Although TMEM242 is not directly linked to apoptosis in the provided texts, understanding the functions of other TMEM family members can provide context . TMEM214, for example, mediates ER stress-induced apoptosis by acting as an anchor for the recruitment of procaspase 4 to the ER, facilitating its activation .

Tables

FeatureDescription
Gene ID729515
FunctionScaffold protein in mitochondrial ATP synthase assembly; modulates ROS levels
Role in HemostasisInfluences coagulation and hemostasis; knockdown leads to increased bleeding and delayed fibrin formation
Impact on ROSDeficiency increases ROS levels, potentially affecting ATP synthase assembly and coagulation factor expression
Associated ConditionsPierpont Syndrome, Leigh Disease
Related transmembrane proteinsTMEM88, TMEM214

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
TMEM242; C6orf35; BM-033; HSPC287; Transmembrane protein 242
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-141
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMEM242
Target Protein Sequence
METAGAATGQPASGLEAPGSTNDRLFLVKGGIFLGTVAAAGMLAGFITTLSLAKKKSPEW FNKGSMATAALPESGSSLALRALGWGSLYAWCGVGVISFAVWKALGVHSMNDFRSKMQSI FPTIPKNSESAVEWEETLKSK
Uniprot No.

Target Background

Database Links

HGNC: 17206

KEGG: hsa:729515

UniGene: Hs.157212

Protein Families
TMEM242 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the basic structure and localization of human TMEM242?

    TMEM242 is a 141 amino acid transmembrane protein encoded by a gene located on chromosome 6q25.3 containing 4 exons. The protein contains a DUF1358 domain (Domain of Unknown Function 1358). Subcellular fractionation and immunofluorescence microscopy confirm that TMEM242 localizes exclusively to mitochondria. It is an integral component of the inner mitochondrial membrane (IMM) as demonstrated by alkaline pH washing experiments, where it resists extraction but can be solubilized with deoxycholate concentrations of 0.5% or greater. Topological studies using trypsinolysis of intact and lysed mitochondria reveal that both N- and C-terminal regions of TMEM242 face the mitochondrial matrix .

  • What is the primary function of TMEM242 in mitochondria?

    TMEM242 functions as a scaffold protein that participates in the assembly of the c8-ring of mitochondrial ATP synthase (F1F0 ATP synthase or complex V). ATP synthase is assembled from 29 component proteins (18 different types), with ATP6 and ATP8 encoded by mitochondrial genes while the remainder are nuclear gene products imported into mitochondria. TMEM242 facilitates membrane insertion and oligomer formation of subunit c/ATP5MC3, helping to form the membrane sector of the enzyme's rotor. Additionally, it influences the incorporation of subunits MT-ATP6, MT-ATP8, ATP5MJ, and ATP5MK into the ATP synthase complex .

  • How does TMEM242 interact with other proteins involved in ATP synthase assembly?

    TMEM242 works in conjunction with another transmembrane protein, TMEM70, to facilitate ATP synthase assembly. Both proteins interact directly with subunit c of ATP synthase, forming high molecular mass complexes with the c-subunit in the range of 60 to 150 kDa. Additionally, both TMEM242 and TMEM70 interact with the mitochondrial complex I assembly (MCIA) complex, which supports assembly of the membrane arm of complex I. TMEM242 has also been shown to interact with proteins including GGT7 and RNF5. Known and predicted interactors also include MAP2K1IP1 (a scaffold protein involved in the MAP Kinase pathway), and multiple other proteins including ELOVL4, GPR42, BCL2L13, and HEATR1 .

Advanced Research Questions

  • What are the differential effects of TMEM242 deletion versus TMEM70 deletion on respiratory chain complexes?

    Deletion studies reveal distinct impacts of TMEM242 and TMEM70 on respiratory complexes:

    DeletionATP SynthaseComplex IComplex IIIComplex IVNotes
    ΔTMEM70Reduced but presentReducedMinimal effectMinimal effectF1-PS-c8-e-f-g subcomplexes predominate
    ΔTMEM242ReducedReducedReducedReducedF1-PS-e-f-g subcomplexes predominate
    ΔTMEM70.ΔTMEM242Nearly absentSeverely reducedReducedReducedEnhanced impact on ATP6, ATP8, j, k subunits

    While TMEM70 primarily affects ATP synthase and complex I assembly, TMEM242 has a broader impact, affecting complexes I, III, and IV. TMEM242 deletion selectively diminishes incorporation of subunits ATP6, ATP8, j, and k into ATP synthase. Double deletion of both proteins prevents ATP synthase assembly completely and has an enhanced impact on complex I assembly .

  • How does TMEM242 contribute to the sequential assembly pathway of ATP synthase?

    Research indicates TMEM242 plays specific roles in multiple stages of ATP synthase assembly:

    1. Early stage: Facilitates the integration of subunit c into the inner mitochondrial membrane

    2. Middle stage: Participates in the formation of c8-rings

    3. Late stage: Influences the incorporation of membrane subunits ATP6, ATP8, j, and k

    The assembly sequence appears to be: after the c8-ring incorporation into the F1-PS-c8-e-f-g subcomplex, subunits ATP6 and ATP8 are added, followed by subunit j (which stabilizes binding of ATP6 and ATP8), and finally subunit k. TMEM242 is particularly critical for these terminal assembly steps, whereas TMEM70 appears to function primarily in earlier stages. This explains why deletion of TMEM242 results in decreased levels of ATP6, ATP8, j, and k in vestigial ATP synthase complexes .

  • What are the physiological consequences of TMEM242 deficiency in zebrafish models and their potential implications for human disease?

    Recent research (2025) using zebrafish tmem242 knockdown models reveals unexpected systemic effects:

    ParameterEffect of tmem242 knockdownMechanism
    HemostasisEnhanced gill bleedingDIC-like conditions
    Thrombocyte countNo significant change-
    Blood aggregationNo significant change-
    CoagulationDelayed (kPTT and kPT assays)Sequestration of clotting factors
    Clotting factor genesIncreased (except f8)ROS-mediated upregulation
    f9a mRNA>10-fold increaseROS→sirt6→nrf2 pathway
    Reactive oxygen speciesSignificantly increasedImpaired ATP synthase
    MicrothrombiPresent in larvaeFactor sequestration

    The mechanism appears to involve: tmem242 deficiency → impaired ATP synthase assembly → increased ROS → activation of sirt6 and nrf2 → upregulation of coagulation factors → DIC-like bleeding. This suggests TMEM242 deficiency could potentially contribute to coagulation disorders in humans through mitochondrial dysfunction-driven ROS production .

Methodological Research Questions

  • What approaches can be used to effectively knock down TMEM242 expression in animal models?

    Research demonstrates successful TMEM242 knockdown using the following methodologies:

    1. Piggyback knockdown in zebrafish: This approach achieved >95% knockdown efficiency as verified by qRT-PCR. The method involves antisense oligonucleotides designed specifically against tmem242.

    2. CRISPR-Cas9 deletion in cell lines: HAP1 cells with TMEM242 deletion (HAP1-ΔTMEM242) have been successfully generated, as well as double knockout lines (HAP1-ΔTMEM70.ΔTMEM242).

    3. Verification methods:

      • qRT-PCR using tmem242-specific primers to confirm transcript reduction

      • Western blotting to verify protein depletion

      • Functional assays (ATP synthase assembly, oxygen consumption, oligomycin sensitivity)

    When designing knockdown experiments, it's important to include appropriate controls and verify knockdown efficiency at both mRNA and protein levels. For zebrafish models specifically, embryos at 3 days post-fertilization (dpf) can be injected with knockdown constructs and assessed at 5-dpf for phenotype development .

  • What methods are optimal for studying TMEM242 protein interactions in mitochondrial membrane complexes?

    Several complementary approaches have proven effective for studying TMEM242 interactions:

    1. Affinity purification with tagged TMEM242:

      • C-terminal Strep II and FLAG tags (TMEM242-t) in HEK293 cells

      • N-terminal FLAG tag (TMEM242-Nt) in HeLa cells

      • Purification via one-step affinity chromatography

    2. Cross-linking coupled with mass spectrometry:

      • Identifies transient or weak interactions within membrane complexes

      • Preserves the native membrane environment

    3. Blue Native PAGE (BN-PAGE):

      • Effective for resolving intact ATP synthase and subcomplexes

      • Can be combined with second-dimension SDS-PAGE for subunit identification

    4. Quantitative proteomics:

      • Comparison of wild-type vs. ΔTMEM242 mitochondrial fractions

      • Identifies changes in complex assembly and stability

    5. Co-immunoprecipitation:

      • Using antibodies against TMEM242 or potential interacting partners

      • Identifying components of MCIA complex interactions

    These techniques have revealed TMEM242 interactions with subunit c of ATP synthase and components of the MCIA complex. For optimal results, mitochondrial isolation should be performed under conditions that preserve membrane protein interactions .

  • How can the impact of TMEM242 on mitochondrial function be comprehensively assessed?

    A multi-parameter approach is recommended for evaluating TMEM242's impact on mitochondrial function:

    1. ATP synthase assembly:

      • Blue Native PAGE followed by Western blotting for ATP synthase subunits

      • Quantitative proteomics of purified ATP synthase complexes

      • Immunodetection of specific subunits (c, ATP8, j)

    2. Respiratory chain function:

      • Oxygen consumption measurements with substrate-specific inhibitors

      • Assessment of oligomycin-sensitive respiration

      • Blue Native PAGE analysis of complexes I, III, and IV

    3. ROS production:

      • DCHF-DA (2′,7′-dichlorodihydrofluorescein diacetate) fluorescence assay

      • Quantitative image analysis of fluorescence intensity

      • Comparison with ATP synthase inhibitors (e.g., oligomycin)

    4. Membrane potential:

      • Potentiometric dyes such as TMRM or JC-1

      • Flow cytometry or confocal microscopy analysis

    5. ATP production:

      • Luciferase-based ATP assays

      • Comparison with glycolytic ATP production

    This comprehensive approach has revealed that TMEM242 deficiency impacts not only ATP synthase assembly but also leads to broader effects on respiratory chain complexes and cellular ROS levels .

  • What expression systems are most effective for producing recombinant TMEM242 protein for structural and functional studies?

    Multiple expression systems have been successfully employed for TMEM242 production:

    Expression SystemTag OptionsPurityApplicationsConsiderations
    HEK293 cellsHis6, Strep II, FLAG>90%Functional studies, Pull-downsMammalian PTMs preserved
    E. coliHis6-ABPVariableAntigen production, Antibody blockingLimited for functional studies
    Cell-free protein synthesisStrep Tag70-80%Rapid screening, Small-scale studiesLower yield

    For structural and functional studies of human TMEM242, mammalian expression systems (particularly HEK293) are preferred as they maintain proper folding and post-translational modifications. His-tagged constructs (AA 1-141) have been successfully produced with >90% purity as determined by Bis-Tris PAGE, anti-tag ELISA, Western Blot and analytical SEC. For optimal purification, one-step affinity chromatography is typically used, with buffer composition often containing mild detergents to maintain the native conformation of this transmembrane protein .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.