Recombinant Human Transmembrane protein 244 (TMEM244)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Human Transmembrane protein 244 (TMEM244) is a protein-coding gene in humans .

Gene ID

The Gene ID for TMEM244 is 253582, updated on January 4, 2025 .

Function and Characteristics

TMEM244 is a transmembrane protein, but its exact function is not yet fully understood . Research indicates that TMEM244 is highly expressed in T-cell lymphoma (TCL) but not in T-cell acute lymphoblastic leukemia (T-ALL) .

Role in Diseases

Diseases associated with TMEM244 include Spermatogenic Failure 5, developmental and epileptic encephalopathy .

Diagnostic Accuracy

TMEM244 expression shows high accuracy in diagnosing TCL compared to T-ALL, with an area under the curve (AUC) of 99.4% (95% CI: 98.2-100%; P < 0.001) . A TMEM244 expression level greater than 1.5 indicates a sensitivity of 95.8% in diagnosing TCL .

TMEM214 and Apoptosis

It's important not to confuse TMEM244 with TMEM214. Transmembrane protein 214 (TMEM214) is a critical mediator of ER stress-induced apoptosis . TMEM214 is localized on the endoplasmic reticulum (ER) and is required for ER stress-induced caspase 4 activation and apoptosis .

TMEM214's Role

  • Apoptosis Induction Overexpression of TMEM214 induces apoptosis .

  • ER Stress Mediation Knockdown of TMEM214 inhibits ER stress-induced apoptosis but not apoptosis induced by TNFα, actinomycin D, or etoposide .

  • Independence from CHOP and JNK TMEM214-mediated apoptosis is independent of CHOP induction or JNK phosphorylation .

  • ER Localization TMEM214 is localized to the outer membrane of the ER .

  • Procaspase 4 Interaction TMEM214 interacts with procaspase 4, which is essential for ER stress-induced apoptosis .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TMEM244; C6orf191; Transmembrane protein 244
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMEM244
Target Protein Sequence
MALQVRVAPSKVVLQKFLLCVILFYTVYYVSLSMGCVMFEVHELNVLAPFDFKTNPSWLN INYKVLLVSTEVTYFVCGLFFVPVVEEWVWDYAISVTILHVAITSTVMLEFPLTSHWWAA LGISKLLV
Uniprot No.

Target Background

Database Links

HGNC: 21571

KEGG: hsa:253582

UniGene: Hs.448372

Subcellular Location
Membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.