Recombinant Human Transmembrane protein 33 (TMEM33)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TMEM33; DB83; Transmembrane protein 33; Protein DB83; SHINC-3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
TMEM33
Target Protein Sequence
MADTTPNGPQGAGAVQFMMTNKLDTAMWLSRLFTVYCSALFVLPLLGLHEAASFYQRALL ANALTSALRLHQRLPHFQLSRAFLAQALLEDSCHYLLYSLIFVNSYPVTMSIFPVLLFSL LHAATYTKKVLDARGSNSLPLLRSVLDKLSANQQNILKFIACNEIFLMPATVFMLFSGQG SLLQPFIYYRFLTLRYSSRRNPYCRTLFNELRIVVEHIIMKPACPLFVRRLCLQSIAFIS RLAPTVP
Uniprot No.

Target Background

Function
TMEM33 acts as a regulator of the tubular endoplasmic reticulum (ER) network. It suppresses RTN3/4-induced ER tubule formation and positively regulates both PERK-mediated and IRE1-mediated unfolded protein response (UPR) signaling.
Gene References Into Functions
  1. TMEM33 is a novel regulator of the PERK-eIF2α-ATF4 and IRE1-XBP1 axes of the UPR signaling pathway. PMID: 26268696
Database Links

HGNC: 25541

KEGG: hsa:55161

STRING: 9606.ENSP00000422473

UniGene: Hs.31082

Protein Families
PER33/POM33 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Melanosome. Nucleus envelope.
Tissue Specificity
Prostate cancer and several cancer cell lines (at protein level). Widely expressed. Expressed at higher levels in endocrine-resistant breast cancer cells as compared to endocrine-sensitive breast cancer cells. Expressed at higher levels in early recurrenc

Q&A

What is the structural characterization of human TMEM33?

TMEM33 is a three-pass transmembrane domain protein that is conserved throughout evolution. Human TMEM33 localizes primarily to the nuclear envelope and endoplasmic reticulum (ER), serving as a regulator of the tubular ER network by suppressing the membrane-shaping activity of reticulons . Experimental approaches to study TMEM33 structure include:

  • Subcellular fractionation combined with immunoblotting to confirm ER localization

  • Immunofluorescence microscopy to visualize subcellular distribution

  • Protein-protein interaction studies to identify structural domains involved in binding to partners like PERK, RNF5, and SCAP

How does TMEM33 regulate calcium homeostasis in cellular systems?

TMEM33 regulates intracellular calcium homeostasis in a polycystin-2 (PC2)-dependent manner. Methodologically, this has been demonstrated through:

  • Calcium imaging techniques to measure intracellular Ca²⁺ oscillations

  • In vivo models showing TMEM33 is required for Vegfa-mediated Ca²⁺ oscillations to promote angiogenesis in zebrafish embryos

  • Studies in renal tubular epithelial cells showing TMEM33 influences cathepsins translocation and sensitization to apoptosis through calcium regulation

What experimental models are available for studying TMEM33 function?

Several experimental models have been developed to study TMEM33:

  • Cell line models: HeLa, SiHa, CaSki, H8 and C33A cancer cell lines express varying levels of TMEM33 suitable for in vitro studies

  • Mouse models: TMEM33+/- mice generated by CRISPR/Cas9-based technology with a 453-bp deletion at Chromosome 5 position 67,263,561 bp, ending after 67,264,013 bp (GRCm38/mm10) followed by a single-bp insertion

  • Inducible knockout systems: 4-OHT-inducible PKM2-KO (PKM2fl/fl, Cre-ERT2) MEF cells can be used to study the relationship between PKM2 and TMEM33

  • Malaria parasite models: Plasmodium berghei studies for examining TMEM33's role in parasite life cycles

How is TMEM33 dysregulated across different cancer types?

Bioinformatic analyses of TCGA and GTEx datasets have revealed:

  • TMEM33 is up-regulated in 24 of 33 cancer types compared with normal tissues

  • In cervical cancer specifically, TMEM33 protein expression is not detected in normal cervix tissue while showing medium expression in cervical cancer tissue

  • ROC curve analysis for TMEM33 discrimination of cervical cancer diagnosis had an AUC of 0.881, indicating strong biomarker potential

For experimental validation, researchers should:

  • Perform RT-qPCR and immunoblotting across multiple cancer cell lines

  • Use immunohistochemistry to compare expression between tumor and adjacent normal tissues

  • Validate findings with patient tissue microarrays containing sufficient sample sizes

What molecular mechanisms underlie TMEM33's role in cancer progression?

Multiple mechanisms have been identified:

  • Cell proliferation pathway: Knockdown of TMEM33 in cervical cancer cells:

    • Decreased cell viability as measured by CCK-8 assay

    • Reduced clonogenicity in colony formation assays

    • Significantly decreased DNA synthesis in EdU incorporation assays

  • Gene regulation network: TMEM33 expression correlates with tumorigenesis-related genes:

    • RNF4 (involved in protein ubiquitination)

    • OCIAD1, TMED5, DHX15, MED28, and LETM1

    • Knockdown of TMEM33 significantly decreases expression of these genes

  • UPR signaling: Overexpression of TMEM33:

    • Increases phosphorylated eIF2α and IRE1α levels

    • Activates downstream effectors ATF4-CHOP and XBP1-S

    • Correlates with increased apoptotic signals (cleaved caspase-7, cleaved PARP)

    • Affects autophagy markers (increased LC3II, reduced p62)

What is the prognostic significance of TMEM33 expression in cancer patients?

Comprehensive survival analyses have shown:

Multivariate Cox analysis results:

VariableHazard Ratio (95% CI)p-value
TMEM33 (High vs Low)3.739 (1.189-11.758)0.024*
T stage (T4 vs T1)84.580 (7.056-1013.898)<0.001***
N stage (N1 vs N0)2.760 (1.023-7.442)0.045*

*p < 0.05, ***p < 0.001

A nomogram incorporating TMEM33 expression with clinical factors shows good agreement between prediction and observed outcomes, suggesting TMEM33 could serve as an independent prognostic biomarker .

How does TMEM33 influence tumor immune microenvironment?

Single-sample Gene Set Enrichment Analysis (ssGSEA) and CIBERSORT analyses have revealed significant correlations between TMEM33 expression and immune cell populations:

Positive correlations with:

  • T helper cells

  • Eosinophils

  • Macrophages M0

  • Mast cells activated

  • T cells CD4 memory resting

Negative correlations with:

  • Dendritic cells (DCs)

  • Th1 cells

  • Regulatory T cells (Tregs)

  • Cytotoxic cells

  • B cells

  • T cells

  • CD56dim NK cells

Experimental approaches to further investigate these relationships include:

  • Flow cytometry of tumor-infiltrating immune cells in TMEM33-high vs TMEM33-low tumors

  • Single-cell RNA sequencing to identify cell-specific effects

  • Co-culture experiments with immune and cancer cells under TMEM33 modulation

What methodologies can assess TMEM33's impact on immune signaling pathways?

To investigate TMEM33's role in immune regulation, researchers should consider:

  • Pathway analysis:

    • GO and KEGG enrichment analyses show DEGs related to TMEM33 are enriched in immune response pathways

    • GSEA to identify affected immune signaling networks

  • Protein complex studies:

    • Co-immunoprecipitation to detect interactions between TMEM33 and immune modulators

    • Evidence suggests TMEM33 co-assembles with TMEM43, TMED1, and ENDOD1 to form a complex modulating innate immune signaling through the cGAS-STING pathway

  • Cytokine profiling:

    • Multiplex assays to measure changes in inflammatory cytokines upon TMEM33 modulation

    • qPCR arrays for immune-related gene expression changes

How does the TMEM33-RNF5-SCAP interaction regulate lipid metabolism?

TMEM33 forms a critical regulatory axis with RNF5 and SCAP that controls lipid metabolism:

  • Complex formation evidence:

    • FLAG-tagged TMEM33 co-immunoprecipitates with both SCAP and RNF5 in multiple cell lines

    • Endogenous TMEM33, RNF5, and SCAP co-immunoprecipitate in MDA-MB-231 cells

    • Direct interaction between TMEM33 and RNF5 confirmed by proximity ligation assay

  • Mechanism of action:

    • TMEM33 overexpression triggers polyubiquitination of SCAP

    • This leads to decreased SCAP protein levels

    • As SCAP is essential for SREBP activation and lipid synthesis, this pathway connects TMEM33 to lipid homeostasis

    • This mechanism appears consistent across different cell types, including cancer cells and MEFs

  • Experimental approaches to study this interaction:

    • In vitro protein-protein interaction assays using T7 Quick Coupled Translation/Transcription systems

    • Mapping interaction domains using truncated protein constructs

    • Ubiquitination assays to quantify SCAP degradation

    • Lipid profiling via lipidomics following TMEM33 modulation

What is the functional relationship between TMEM33 and UPR in cancer cells?

TMEM33 serves as a critical regulator of the unfolded protein response:

  • TMEM33-PERK interaction:

    • TMEM33 is a binding partner of PERK, a key UPR sensor

    • This interaction positions TMEM33 as a potential regulator of UPR initiation

  • Effect on UPR pathways:

    • Exogenous TMEM33 expression increases phosphorylated eIF2α and IRE1α levels

    • Activates downstream effectors ATF4-CHOP and XBP1-S respectively

    • TMEM33 overexpression in breast cancer cells induces robust cell death that can be blocked by eIF2α inhibitor ISRIB

    • Activates UPR-associated pro-death JNK-p53 signaling

  • Autophagy regulation:

    • TMEM33 overexpression induces autophagy in breast cancer cells

    • Inhibition of autophagy (using chloroquine or Atg5 knockdown) sensitizes cells to TMEM33-induced death

    • Overexpression of Beclin-1 decreases TMEM33-induced cell death

These findings position TMEM33 as a potential therapeutic target at the intersection of ER stress, apoptosis, and autophagy pathways.

What are the optimal protocols for TMEM33 knockdown and overexpression studies?

Based on successful published methodologies:

For knockdown experiments:

  • siRNA transfection has been effectively used in HeLa and SiHa cell lines

  • Validation of knockdown efficiency via RT-qPCR and western blot is essential

  • Functional readouts should include proliferation assays (CCK-8, colony formation, EdU incorporation)

  • Analyze expression changes in related genes (RNF4, OCIAD1, TMED5, DHX15, MED28, LETM1)

For overexpression studies:

  • Flag-tagged full-length TMEM33 constructs can be used for protein interaction studies

  • Halo-tagged TMEM33-HA and truncation constructs help map interaction domains

  • For in vivo production, T7 Quick Coupled Translation/Transcription systems are effective

  • Readouts should include UPR pathway activation, apoptosis markers, and autophagy indicators

How can researchers resolve contradictory findings about TMEM33's role in different cancer types?

When addressing seemingly contradictory results:

  • Context-dependent functions:

    • TMEM33 promotes proliferation in cervical cancer cells

    • Yet induces apoptosis via UPR signaling in breast cancer cells

    • These opposing effects may reflect tissue-specific roles or interaction partners

  • Methodological approach to resolve contradictions:

    • Perform parallel experiments in multiple cell types under identical conditions

    • Use dose-dependent studies to identify threshold effects

    • Investigate temporal dynamics of TMEM33 function

    • Compare acute vs. chronic modulation of TMEM33 levels

    • Examine post-translational modifications that might alter function

    • Consider genetic background differences between model systems

  • Integrative analysis:

    • Combine transcriptomic, proteomic, and functional data across systems

    • Network analysis to identify context-specific interactors

    • Develop computational models to predict cell-type specific effects

What are the best model systems for studying TMEM33 function in disease contexts?

When selecting appropriate model systems:

  • Cancer models:

    • Cervical cancer: HeLa (HPV18+) and SiHa (HPV16+) cell lines show high TMEM33 protein expression

    • Breast cancer: MCF7 and MDA-MB-231 cells have been used successfully for TMEM33 studies

    • Patient-derived xenografts to validate findings in more clinically relevant settings

  • Mouse models:

    • TMEM33+/- mice generated by CRISPR/Cas9 technology (453-bp deletion at Chr5)

    • Rosa26-creER and PKM conditional knockout models to study PKM2-TMEM33 axis

    • Tamoxifen-inducible systems for temporal control of gene expression

  • Parasite models:

    • Plasmodium berghei for studying TMEM33's role across parasite life cycles

    • C-terminal tagging approaches to visualize localization in blood and mosquito stages

  • Comparative approach recommendations:

    • Use multiple models in parallel to cross-validate findings

    • Include both in vitro and in vivo systems when possible

    • Consider 3D organoid cultures to better recapitulate tissue architecture

    • Include patient samples for clinical validation of experimental findings

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.