Recombinant Human Transmembrane protein 40 (TMEM40)

Shipped with Ice Packs
In Stock

Description

Introduction

Transmembrane protein 40 (TMEM40) is a protein-coding gene in humans . Research indicates that TMEM40 is linked to the progression of tongue squamous cell carcinoma (TSCC) . Further studies suggest that TMEM40 could serve as a diagnostic biomarker for bladder cancer .

Basic Information

TMEM40 is a protein-coding gene that produces a 23-kDa protein .

Expression Analysis in Bladder Cancer

TMEM40 expression is frequently upregulated in bladder cancer tissues compared to normal bladder tissues . In one study, TMEM40 expression was positive in 68.1% of bladder cancer cases and negative in 31.9% of cases. In normal bladder tissues, TMEM40 staining was positive in only 2.3% of cases and negative in 97.7% of cases . High TMEM40 expression is associated with bladder cancer, suggesting its potential as a diagnostic biomarker .

Table 1: TMEM40 Expression in Bladder Cancer vs. Normal Tissues

Tissue TypePositive TMEM40 Expression (n)Negative TMEM40 Expression (n)
Bladder Cancer4923
Normal Bladder Tissue142

TMEM40 expression is significantly associated with histological grade and clinical stage (P<0.05) . Statistical analyses were performed using SPSS 20.0 software, and a Chi-square test showed that TMEM40 expression was significantly higher in tumor tissues (χ2=47.331, P=0.000) .

Role in Tongue Squamous Cell Carcinoma (TSCC)

Studies have found that TMEM40 expression is increased in TSCC tissues and is associated with clinicopathological parameters . TMEM40 promotes cell proliferation, colony formation, migration, and invasion in TSCC cells .

Effects on TSCC Cells :

  • Cell Proliferation: TMEM40 induces cell proliferation in TSCC cells.

  • Colony Formation: TMEM40 promotes colony formation in TSCC cells.

  • Cell Apoptosis: TMEM40 inhibits cell apoptosis in TSCC.

  • Cell Cycle: High expression of TMEM40 promotes proliferation and low expression induces cell cycle arrest at the G0/G1 phase.

  • Cell Migration and Invasion: TMEM40 promotes cell migration and invasion of TSCC cells.

Table 2: Effects of TMEM40 on TSCC Cells

EffectResult
Cell ProliferationIncreased with TMEM40 overexpression, decreased with TMEM40 silencing
Colony FormationPromoted by TMEM40 overexpression, suppressed by TMEM40 silencing
Cell ApoptosisInhibited by TMEM40 overexpression, increased by TMEM40 silencing
Cell CyclePromoted by TMEM40 overexpression, suppressed by TMEM40 silencing
Cell Migration/InvasionIncreased with TMEM40 overexpression, decreased with TMEM40 silencing

Molecular Mechanisms

Knockdown of TMEM40 increases the levels of p53 and activated Bax, indicating that TMEM40 suppresses apoptosis of TSCC cells via p53- and Bax-associated pathways . TMEM40 also affects cell invasion ability via Matrix metalloproteinases (MMPs) . Low levels of MMP-9 were observed in TMEM40-silenced TSCC cells .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
TMEM40; Transmembrane protein 40
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-233
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMEM40
Target Protein Sequence
METSASSSQPQDNSQVHRETEDVDYGETDFHKQDGKAGLFSQEQYERNKSSSSSSSSSSS SSSSSSSSSSESNDEDQQPRATGKHRRSLGAGYPHGNGSPGPGHGEPDVLKDELQLYGDA PGEVVPSGESGLRRRGSDPASGEVEASQLRRLNIKKDDEFFHFVLLCFAIGALLVCYHYY ADWFMSLGVGLLTFASLETVGIYFGLVYRIHSVLQGFIPLFQKFRLTGFRKTD
Uniprot No.

Target Background

Database Links

HGNC: 25620

KEGG: hsa:55287

UniGene: Hs.475502

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TMEM40 and what cellular functions has it been associated with?

TMEM40 (Transmembrane Protein 40) is a membrane-spanning protein that has been implicated in several critical cellular processes. Research indicates that TMEM40 plays important roles in cell cycle regulation, cellular proliferation, migration, and invasion capabilities in various cell types. The protein has been found to be differentially expressed between normal and cancerous tissues, with notably higher expression in cancer cells compared to normal counterparts. This differential expression pattern suggests TMEM40 may function in pathways controlling cellular growth and survival.

In cutaneous squamous cell carcinoma (CSCC), TMEM40 has been shown to regulate cell growth through effects on cell cycle progression and apoptosis, indicating its potential involvement in fundamental cellular growth control mechanisms . Similarly, in cervical cancer, TMEM40 has been linked to proliferation pathways and appears to inhibit apoptotic mechanisms while promoting cell survival . These consistent findings across multiple cancer types suggest TMEM40 may serve as a key regulatory protein in cellular homeostasis.

How can TMEM40 expression be accurately detected and quantified in research settings?

Detection and quantification of TMEM40 can be accomplished through several complementary methodologies, depending on whether researchers are interested in mRNA or protein expression. For mRNA expression analysis, reverse transcription-quantitative PCR (RT-qPCR) is the gold standard. According to published protocols, researchers should extract total RNA using commercial kits (such as PureLink RNA Mini kit), measure RNA concentration via spectrophotometry, and perform reverse transcription using appropriate kits (e.g., TaqMan MicroRNA Reverse Transcription kit) .

For TMEM40 RT-qPCR analysis, validated primers are available, including the forward primer 5'-GCGGTAGGGGTGTACGGT-3' and reverse primer 5'-CCGGACACGCTGAACTTGT-3' . Expression should be normalized to housekeeping genes such as GAPDH, with data analyzed using the 2^-ΔΔCq method.

For protein expression analysis, western blotting provides reliable results. Protein extraction from tissue samples or cell lines should be performed using RIPA buffer containing protease inhibitors. Approximately 40 μg of protein per sample should be separated via SDS-PAGE, transferred to membranes, and probed with specific anti-TMEM40 antibodies. Commercially available antibodies include mouse anti-TMEM40 (1:500 dilution, Santa Cruz Biotechnology, cat. no. sc-393601) . Expression patterns can be visualized using enhanced chemiluminescence detection systems.

What experimental cell models are most appropriate for TMEM40 research?

Based on current literature, several validated cell models have proven effective for TMEM40 research. For cutaneous squamous cell carcinoma studies, the A431 and SCL-1 cell lines have been successfully employed to investigate TMEM40 function . These cells can be maintained in high-glucose DMEM supplemented with 10% FBS and 1% penicillin/streptomycin in standard cell culture conditions (37°C, 5% CO₂).

For cervical cancer research, multiple cell lines have demonstrated differential TMEM40 expression and responsiveness to experimental manipulation . When selecting an appropriate cell model, researchers should consider baseline TMEM40 expression levels, which can be determined through RT-qPCR and western blot analyses prior to experimentation.

For transfection experiments, both cell types show acceptable efficiency with standard lipid-based transfection reagents. When conducting TMEM40 silencing experiments, researchers should validate knockdown efficiency at both mRNA and protein levels approximately 48 hours post-transfection before proceeding with functional assays .

Cell models should be carefully selected based on research objectives; metastatic cell lines may be more appropriate for invasion studies, while primary cell lines might better represent early carcinogenic events in TMEM40 function analysis.

What are the molecular mechanisms through which TMEM40 influences cancer cell proliferation and invasion?

TMEM40 operates through multiple signaling pathways to influence cancer cell behavior. In cervical cancer, TMEM40 has been shown to regulate the expression of several key oncogenic proteins. Specifically, silencing TMEM40 with shRNA downregulates the expression of c-MYC and Cyclin D1, both critical regulators of cell proliferation and cell cycle progression . This suggests that TMEM40 exerts its proliferative effects at least partly through modulation of these oncogenes.

Additionally, TMEM40 influences the extracellular matrix degradation capacity of cancer cells by regulating matrix metalloproteinases. Research has demonstrated that TMEM40 silencing significantly decreases the expression of MMP-1 and MMP-9, which are essential for cellular invasion through basement membranes and stromal tissues . This mechanism explains how TMEM40 contributes to the invasive phenotype observed in multiple cancer types.

TMEM40 also interfaces with the p53 tumor suppressor pathway. When TMEM40 is silenced, researchers observe increased activation of p53 and several downstream apoptosis executors including Caspase-3, Caspase-9, and PARP1 . This suggests TMEM40 may normally function to suppress p53-dependent apoptotic mechanisms, thereby promoting cancer cell survival. The molecular interactions between TMEM40 and these signaling pathways reveal its multifaceted role in driving malignant phenotypes through simultaneous effects on proliferation, invasion, and apoptosis resistance.

How does TMEM40 affect cell cycle regulation in different cellular contexts?

TMEM40 exhibits differential effects on cell cycle regulation depending on whether it is being overexpressed or silenced. In cervical cancer cell lines, upregulation of TMEM40 via expression vectors leads to a distinct S phase cell cycle arrest, suggesting it may promote DNA replication and cellular proliferation . Conversely, silencing TMEM40 with shRNA induces G0/G1 cell cycle arrest, preventing cells from entering the S phase .

Similar cell cycle effects have been observed in cutaneous squamous cell carcinoma, where silencing TMEM40 in A431 and SCL1 cells resulted in significant G0/G1 phase arrest . This indicates TMEM40 plays a critical role in regulating the G1-to-S phase transition across multiple cancer types.

The molecular mechanism behind these cell cycle effects involves TMEM40's regulation of cell cycle proteins. Silencing TMEM40 decreases expression of Cyclin D1 , which normally forms complexes with CDK4/6 to phosphorylate Rb and allow E2F-dependent transcription of S-phase genes. Additionally, TMEM40 appears to interface with the p53 pathway , which is a master regulator of G1 checkpoint control. By modulating these key cell cycle regulators, TMEM40 exerts substantial control over cancer cell proliferation rates and may represent a valuable target for cell cycle-based therapeutic approaches.

What are the most effective methods for producing functional recombinant human TMEM40?

While the provided search results don't specifically detail methods for producing recombinant human TMEM40, we can extrapolate from related recombinant transmembrane protein production methodologies. Based on successful approaches with other transmembrane proteins like OX40L described in the search results , an effective expression system would likely involve:

  • Design of an expression construct containing:

    • An appropriate signal sequence (such as BM40) for proper membrane targeting

    • The full-length human TMEM40 coding sequence with codon optimization for the expression host

    • Purification tags (His-tag or Fc-fusion) positioned to minimize interference with protein folding

    • Appropriate restriction sites for cloning flexibility (NheI, SacI, EcoRI, XhoI)

  • Selection of an expression system:

    • Mammalian expression (HEK293 or CHO cells) would likely yield properly folded and post-translationally modified TMEM40

    • Transient transfection using pCEP-derived vectors has proven successful for other transmembrane proteins

    • Stable cell line generation may provide more consistent protein yields for long-term studies

  • Purification approach:

    • Detergent solubilization optimization to maintain protein structure and function

    • Affinity chromatography using tag-specific resins

    • Size exclusion chromatography to ensure homogeneity

  • Functional validation:

    • Western blotting to confirm expression and molecular weight

    • Cell-based assays to verify biological activity

    • Structural analysis through velocity sedimentation to determine protein assembly state

Researchers should note that producing functional recombinant transmembrane proteins presents unique challenges compared to soluble proteins, particularly in maintaining native conformation and function after extraction from membrane environments.

How can TMEM40 be effectively targeted for potential cancer therapy?

Based on the demonstrated role of TMEM40 in promoting cancer cell proliferation, invasion, and survival, several therapeutic targeting strategies can be considered:

  • RNA interference approaches:

    • siRNA or shRNA targeting TMEM40 has shown efficacy in preclinical models, inducing G0/G1 cell cycle arrest, promoting apoptosis, and inhibiting migration and invasion in both cutaneous squamous cell carcinoma and cervical cancer cell lines .

    • In vivo experiments have demonstrated that TMEM40 silencing dramatically decreases tumor growth in xenograft mouse models , validating this approach for potential therapeutic development.

  • Small molecule inhibitors:

    • Rational design of small molecule inhibitors targeting TMEM40 protein-protein interactions could disrupt its downstream signaling pathways.

    • High-throughput screening approaches could identify compounds that modulate TMEM40 expression or function.

  • Antibody-based therapies:

    • Developing neutralizing antibodies against TMEM40's extracellular domains could interfere with its function.

    • Antibody-drug conjugates could specifically deliver cytotoxic payloads to TMEM40-overexpressing cancer cells.

  • Combination therapy approaches:

    • Since TMEM40 silencing activates p53 and apoptosis-related proteins , combining TMEM40 targeting with traditional chemotherapeutics might enhance treatment efficacy.

    • TMEM40 inhibition could potentially sensitize resistant tumors to existing therapies by removing proliferative and anti-apoptotic signals.

The development of TMEM40-targeted therapies would be particularly beneficial for cancers where TMEM40 expression correlates with tumor size and lymph node metastasis, such as cervical cancer and cutaneous squamous cell carcinoma , where it could serve as both a prognostic biomarker and therapeutic target.

What experimental approaches are most effective for studying TMEM40 function in cancer?

Multiple complementary experimental approaches provide robust insights into TMEM40 function:

  • Gene expression modulation:

    • RNA interference (siRNA/shRNA) has proven highly effective for TMEM40 silencing, with validated protocols established in multiple cancer cell lines .

    • Overexpression vectors (OE-TMEM40) enable gain-of-function studies to complement silencing experiments .

    • CRISPR-Cas9 gene editing could provide complete knockout models for more definitive functional studies.

  • Proliferation assays:

    • Cell Counting Kit-8 (CCK-8) assays provide reliable quantification of proliferation changes following TMEM40 modulation .

    • 5-ethynyl-2'-deoxyuridine (EdU) incorporation assays offer direct measurement of DNA synthesis rates .

    • Colony formation assays assess long-term proliferative capacity and are particularly valuable for determining clonogenic potential .

    • ³H-thymidine incorporation assays can measure cell proliferation with high sensitivity .

  • Migration and invasion assessment:

    • Wound healing assays quantify collective cell migration following experimental TMEM40 manipulation .

    • Transwell assays with or without Matrigel coating evaluate both migration and invasion capabilities .

  • Cell cycle and apoptosis analysis:

    • Flow cytometry with propidium iodide staining provides detailed cell cycle distribution data .

    • Annexin V/PI staining enables precise quantification of early and late apoptotic cell populations .

    • Western blotting for apoptosis-related proteins (Caspase-3, Caspase-9, PARP1) confirms mechanistic details .

  • In vivo validation:

    • Xenograft mouse models have successfully demonstrated the effects of TMEM40 silencing on tumor growth, providing critical translational relevance to in vitro findings .

These methodologies should be implemented with appropriate controls and standardized protocols to ensure reproducibility and reliability of results across different cancer models.

What are the key considerations when designing TMEM40 knockdown or overexpression experiments?

Successful TMEM40 manipulation experiments require careful attention to several critical factors:

  • Vector selection and design:

    • For knockdown experiments, validated shRNA sequences targeting TMEM40 have demonstrated high efficiency in multiple cancer cell types .

    • For overexpression, mammalian expression vectors with strong promoters (CMV) and appropriate tags for detection should be employed .

    • Include selection markers (puromycin/neomycin resistance) for establishing stable cell lines when needed.

  • Transfection optimization:

    • Cell density at transfection significantly impacts efficiency; typically, 60-70% confluence yields optimal results.

    • Transfection reagent-to-DNA ratios require optimization for each cell line to maximize efficiency while minimizing toxicity.

    • Serum-free conditions during transfection often improve uptake, but duration should be limited to prevent excessive cellular stress.

  • Validation of manipulation:

    • Confirm knockdown or overexpression at both mRNA and protein levels using RT-qPCR and western blotting respectively .

    • Establish expression kinetics post-transfection to determine optimal timepoints for subsequent functional assays.

    • For TMEM40 mRNA quantification, use validated primers such as forward 5'-GCGGTAGGGGTGTACGGT-3' and reverse 5'-CCGGACACGCTGAACTTGT-3' .

  • Experimental controls:

    • Include scrambled shRNA controls for knockdown experiments to account for non-specific effects.

    • Use empty vector controls for overexpression studies.

    • Consider rescue experiments by re-introducing shRNA-resistant TMEM40 to confirm phenotype specificity.

  • Timing considerations:

    • Functional assays should be performed at timepoints when TMEM40 expression changes are confirmed (typically 48-72 hours post-transfection) .

    • For stable expression models, allow sufficient time for selection and expansion before conducting experiments.

Careful attention to these design considerations will maximize experimental reproducibility and the biological relevance of findings related to TMEM40 function in cancer.

How can researchers investigate the interaction between TMEM40 and the p53 signaling pathway?

The demonstrated relationship between TMEM40 and p53 signaling warrants detailed investigation through multiple complementary approaches:

  • Protein expression correlation analysis:

    • Western blot analysis comparing TMEM40 expression with p53 and its downstream targets (p21, PUMA, BAX) in various cancer cell lines and tissue samples.

    • Immunohistochemistry on serial tissue sections to evaluate spatial correlation between TMEM40 and p53 pathway components.

  • Co-immunoprecipitation studies:

    • Pull-down assays using anti-TMEM40 antibodies followed by western blotting for p53 and related proteins to identify potential direct interactions.

    • Reciprocal co-IP using anti-p53 antibodies to confirm interactions.

    • Include appropriate negative controls and validation using recombinant proteins.

  • Gene expression modulation experiments:

    • Silence TMEM40 using validated shRNA approaches and measure changes in p53 activation status and downstream targets .

    • Overexpress TMEM40 and assess suppression of p53 pathway activity.

    • Perform these experiments in both p53-wild-type and p53-mutant/null backgrounds to determine dependency.

  • Functional rescue experiments:

    • In TMEM40-silenced cells showing enhanced p53 activity, simultaneously suppress p53 to determine if this rescues the phenotypic effects.

    • This approach can establish causality in the relationship between TMEM40 and p53 signaling.

  • Transcriptional activity assays:

    • Employ p53 reporter constructs (containing p53 response elements driving luciferase expression) to quantify p53 transcriptional activity following TMEM40 manipulation.

    • Chromatin immunoprecipitation (ChIP) assays to assess p53 binding to target promoters with and without TMEM40 modulation.

  • Cell cycle and apoptosis analysis:

    • Flow cytometry with propidium iodide staining and Annexin V/PI to quantify cell cycle distribution and apoptosis rates in response to combined TMEM40 and p53 pathway manipulation.

These methodological approaches would provide comprehensive insights into the mechanistic relationship between TMEM40 and the p53 tumor suppressor pathway, potentially revealing new therapeutic opportunities.

How can TMEM40 expression serve as a prognostic biomarker in cancer?

TMEM40 has demonstrated significant potential as a prognostic biomarker across multiple cancer types. In cervical cancer, TMEM40 elevation is closely correlated with clinically relevant parameters including tumor size and lymph node metastasis . Similarly, in cutaneous squamous cell carcinoma, increased TMEM40 expression is associated with larger tumor size . These consistent clinical correlations suggest TMEM40 could serve as a valuable prognostic indicator.

Quantitative PCR could provide complementary molecular assessment in cases where tissue is limited or for verification of IHC results. The validated primers (forward: 5'-GCGGTAGGGGTGTACGGT-3', reverse: 5'-CCGGACACGCTGAACTTGT-3') enable reliable quantification when normalized to appropriate housekeeping genes .

For translational implementation, large-scale retrospective and prospective studies correlating TMEM40 expression with patient outcomes, treatment response, and survival are necessary to establish definitive clinical utility and appropriate cutoff values for different cancer types.

What are the future directions for TMEM40 research in cancer biology?

Several promising research directions could significantly advance our understanding of TMEM40 in cancer:

  • Comprehensive molecular characterization:

    • Proteomics approaches to identify TMEM40 binding partners across different cancer types.

    • Structural studies to elucidate TMEM40's membrane topology and functional domains.

    • Investigation of post-translational modifications that regulate TMEM40 activity.

  • Expanded cancer type profiling:

    • While TMEM40's role has been established in cutaneous squamous cell carcinoma and cervical cancer , systematic evaluation across additional cancer types is warranted.

    • Development of a TMEM40 expression atlas across cancer types would identify where targeting TMEM40 might provide the greatest therapeutic benefit.

  • Mechanistic studies:

    • Deeper investigation of TMEM40's interaction with the p53 pathway to determine whether the relationship is direct or indirect .

    • Exploration of potential interactions with receptor tyrosine kinase signaling networks.

    • Investigation of TMEM40's role in cancer stem cell maintenance and therapy resistance.

  • Therapeutic development:

    • High-throughput screening for small molecule modulators of TMEM40 expression or function.

    • Development of monoclonal antibodies targeting TMEM40's extracellular domains.

    • Exploration of TMEM40-targeting nanoparticle delivery systems for siRNA/shRNA approaches.

  • Clinical correlation studies:

    • Large-scale analysis correlating TMEM40 expression with response to standard therapies across cancer types.

    • Investigation of TMEM40 as a circulating biomarker in liquid biopsies.

    • Evaluation of TMEM40 expression changes during cancer progression and metastasis.

These research directions would significantly enhance our understanding of TMEM40's role in cancer biology and accelerate the development of TMEM40-targeted therapeutic strategies.

What are the main technical difficulties in studying transmembrane proteins like TMEM40?

Investigating transmembrane proteins presents several unique challenges compared to soluble proteins:

  • Expression and purification obstacles:

    • Transmembrane proteins often express poorly in heterologous systems due to toxicity or improper folding.

    • Membrane extraction requires careful optimization of detergent conditions to maintain protein structure and function.

    • Purification yields are typically lower than for soluble proteins, limiting certain analytical approaches.

  • Structural characterization limitations:

    • Crystallization of transmembrane proteins is notoriously difficult due to their amphipathic nature.

    • Traditional structure determination methods may require modification with fusion partners or crystallization chaperones.

    • Alternative approaches like cryo-EM might be necessary but require specialized equipment and expertise.

  • Functional assay complexities:

    • Maintaining native membrane environment during functional studies is challenging.

    • Reconstitution into artificial membrane systems or nanodiscs may be necessary but can introduce artifacts.

    • Cell-based assays must carefully distinguish direct TMEM40 effects from indirect downstream consequences.

  • Antibody generation difficulties:

    • The limited extracellular domain size of some transmembrane proteins restricts epitope availability.

    • Conformational epitopes may be lost when proteins are denatured for immunization or detection.

    • Cross-reactivity with related membrane proteins can complicate specificity.

Solutions to these challenges include:

  • Development of optimized expression systems specifically for transmembrane proteins

  • Use of fusion partners that enhance folding and expression (e.g., Fc domains)

  • Implementation of membrane mimetics that better preserve native protein structure

  • Application of proximity labeling approaches to identify interaction partners in intact cells

  • Development of conformation-specific antibodies that recognize native protein structures

Researchers investigating TMEM40 should anticipate these technical challenges and incorporate appropriate methodological adaptations in their experimental design.

How can researchers overcome variability in TMEM40 expression studies?

Achieving consistent and reliable TMEM40 expression data requires addressing several sources of variability:

  • Standardization of sample preparation:

    • For tissue samples, standardize collection procedures, including cold ischemia time and fixation protocols.

    • Implement laser capture microdissection when analyzing heterogeneous tissues to ensure cell-type specificity.

    • For cell lines, standardize culture conditions, passage number, and confluence levels at harvest.

  • RT-qPCR optimization:

    • Use multiple reference genes (beyond just GAPDH) selected for stability in the specific tissue/condition being studied.

    • Implement rigorous primer validation including efficiency testing and melt curve analysis.

    • Follow MIQE (Minimum Information for Publication of Quantitative Real-Time PCR Experiments) guidelines.

    • Use the validated TMEM40 primers (forward: 5'-GCGGTAGGGGTGTACGGT-3', reverse: 5'-CCGGACACGCTGAACTTGT-3') .

  • Western blot standardization:

    • Implement PVDF membrane blocking optimization to reduce background.

    • Use validated antibodies at consistent dilutions (e.g., mouse anti-TMEM40 at 1:500) .

    • Include loading controls appropriate for the experimental conditions.

    • Employ quantitative detection methods (e.g., fluorescence-based) rather than chemiluminescence when possible.

  • Immunohistochemistry consistency:

    • Use automated staining platforms to minimize procedural variation.

    • Implement digital pathology quantification rather than subjective scoring when possible.

    • Include positive and negative control tissues in each staining batch.

    • Follow the established semi-quantitative scoring system combining percentage positive cells (0-4) and staining intensity (0-3) .

  • Statistical approaches:

    • Determine appropriate sample sizes through power analysis before beginning experiments.

    • Use matched normal-tumor pairs when possible to control for inter-individual variation.

    • Implement robust statistical methods appropriate for the data distribution.

    • Report effect sizes alongside p-values to better communicate biological significance.

Implementation of these standardization approaches will significantly improve reproducibility and reliability in TMEM40 expression studies.

How might TMEM40 be involved in therapy resistance mechanisms in cancer?

While direct evidence for TMEM40's role in therapy resistance is not explicitly detailed in the provided search results, several observed functions suggest potential involvement in resistance mechanisms:

  • Cell survival pathway modulation:

    • TMEM40 has been shown to inhibit apoptosis and promote cell survival , which are fundamental mechanisms of therapy resistance.

    • Its interaction with the p53 pathway is particularly relevant, as p53 dysfunction is a major contributor to treatment resistance in multiple cancer types.

    • Activation of anti-apoptotic proteins through TMEM40-dependent signaling could potentially confer resistance to both chemotherapy and targeted therapies.

  • Cell cycle regulation effects:

    • TMEM40's involvement in cell cycle progression could influence sensitivity to cycle-dependent therapies.

    • The observed G0/G1 arrest upon TMEM40 silencing suggests it may normally promote cell cycle progression through restriction points that are targeted by many cancer therapies.

  • Potential involvement in cancer stem cell phenotypes:

    • Given TMEM40's roles in migration, invasion, and proliferation , it may contribute to cancer stem cell-like properties.

    • Cancer stem cells are widely recognized as key drivers of therapy resistance and disease recurrence.

  • Interaction with tumor microenvironment:

    • TMEM40's regulation of matrix metalloproteinases (MMP-1, MMP-9) suggests it influences tumor-microenvironment interactions.

    • Such interactions are increasingly recognized as critical determinants of therapy response.

Future research directions should include:

  • Comparing TMEM40 expression in therapy-sensitive versus resistant cancer models

  • Evaluating whether TMEM40 silencing can resensitize resistant cells to standard therapies

  • Investigating TMEM40 expression changes in response to treatment pressure

  • Exploring combinatorial approaches targeting TMEM40 alongside conventional therapies

These investigations could potentially establish TMEM40 as a biomarker for therapy resistance and a target for sensitization strategies.

What is the potential role of TMEM40 in cancer metastasis?

TMEM40 appears to play significant roles in biological processes essential for metastasis, as evidenced by multiple experimental findings:

  • Enhanced migration and invasion capacity:

    • Silencing TMEM40 significantly inhibits migration and invasion in both cutaneous squamous cell carcinoma and cervical cancer cells .

    • Conversely, TMEM40 upregulation promotes these metastasis-associated behaviors .

    • These functional effects directly support TMEM40's involvement in the fundamental cellular processes required for metastatic spread.

  • Regulation of matrix metalloproteinases:

    • TMEM40 silencing downregulates the expression of MMP-1 and MMP-9 , which are critical enzymes for degrading extracellular matrix barriers during invasion and metastasis.

    • This mechanistic link provides a molecular explanation for TMEM40's effects on invasive capacity.

  • Clinical correlation with metastatic disease:

    • In cervical cancer patients, TMEM40 elevation is closely correlated with lymph node metastasis , providing direct clinical evidence for its relevance to metastatic progression.

    • This clinical association supports the translational significance of the experimental findings.

  • Potential epithelial-mesenchymal transition (EMT) involvement:

    • While not explicitly demonstrated in the provided search results, TMEM40's effects on migration and invasion suggest possible involvement in EMT regulation.

    • Further investigation of TMEM40's relationship with EMT markers (E-cadherin, N-cadherin, vimentin) would be valuable.

Future research priorities should include:

  • In vivo metastasis models to directly assess TMEM40's impact on metastatic spread

  • Investigation of circulating tumor cells for TMEM40 expression

  • Analysis of TMEM40 expression in matched primary tumors versus metastatic lesions

  • Exploration of TMEM40-targeted therapies specifically for preventing or treating metastatic disease

These studies would further clarify TMEM40's role as a potential driver of metastasis and therapeutic target for advanced disease.

How does TMEM40 function compare across different cancer types?

Comparative analysis of TMEM40 across cancer types reveals both consistent patterns and potential context-specific functions:

Cancer TypeExpression PatternAssociated Clinical FeaturesFunctional EffectsMolecular MechanismsReference
Cutaneous Squamous Cell Carcinoma (CSCC)Increased in cancer vs. normal tissueAssociated with larger tumor sizeRegulates cell growth through cell cycle and apoptosis effects; Promotes migration and invasionSilencing causes G0/G1 arrest and promotes apoptosis
Cervical Cancer (CC)Elevated in CC tissues and cell linesCorrelated with tumor size and lymph node metastasisPromotes invasion, migration, and proliferation; Inhibits apoptosis; Leads to S phase cell cycle arrest when upregulatedRegulates c-MYC, Cyclin D1, MMP-1, MMP-9; Interfaces with p53 pathway

Common features across both cancer types include:

  • Consistently elevated expression in cancerous versus normal tissues

  • Strong association with increased tumor size

  • Promotion of migration and invasion capabilities

  • Regulation of cell cycle progression

  • Inhibition of apoptotic mechanisms

Potential differences include:

  • Specific cell cycle effects (S phase arrest with upregulation in CC vs. G0/G1 arrest with silencing in both)

  • Detailed molecular mechanisms (more extensively characterized in CC, including specific downstream effectors)

  • Clinical correlations (lymph node metastasis association specifically noted in CC)

These comparisons suggest TMEM40 may serve as a broadly relevant oncogenic factor across multiple cancer types, with some context-specific mechanisms that warrant further investigation in additional cancer models.

What is the relationship between TMEM40 and other transmembrane proteins in cancer biology?

While the provided search results don't directly compare TMEM40 with other transmembrane proteins, several important considerations can guide future comparative studies:

  • Structural and functional classification:

    • TMEM40 belongs to the broader transmembrane protein family, which includes various subfamilies with diverse functions.

    • Comparative structural analysis with other TMEM family members could reveal functional motifs and conserved domains that provide insights into TMEM40's mechanisms.

    • Phylogenetic analysis across species could identify evolutionarily conserved features indicating fundamental cellular functions.

  • Signaling pathway integration:

    • Many transmembrane proteins serve as receptors or co-receptors in signaling cascades.

    • TMEM40's demonstrated effects on downstream signaling molecules (c-MYC, Cyclin D1, MMPs) suggest it may function within established signaling networks.

    • Comparative pathway analysis could position TMEM40 within the broader context of cancer signaling networks.

  • Expression pattern correlations:

    • Co-expression analysis across cancer types could identify transmembrane proteins with expression patterns similar to TMEM40.

    • Such correlations might reveal functional relationships or co-regulatory mechanisms.

    • Public databases like TCGA could be leveraged for these comparative analyses across multiple cancer types.

  • Therapeutic targeting considerations:

    • Comparison with successfully targeted transmembrane proteins (e.g., receptor tyrosine kinases) could inform therapeutic development strategies.

    • Lessons from antibody development against other transmembrane targets could be applied to TMEM40-targeting approaches.

    • The recombinant protein design principles used for OX40L could potentially be adapted for TMEM40-based biologics.

Future research should systematically compare TMEM40 with other cancer-associated transmembrane proteins to better understand its unique and shared functions within this important protein class.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.