Recombinant Human Transmembrane protein 41A (TMEM41A)

Shipped with Ice Packs
In Stock

Description

Biological Functions

  • Autophagy and Lipid Metabolism: Facilitates membrane curvature during autophagosome biogenesis .

  • Cancer Progression: Overexpression correlates with metastatic potential in gastric, endometrial, and breast cancers by promoting cell migration and cytoskeletal rearrangements .

  • Immune Modulation: Linked to stromal and immune cell infiltration in tumors, including NK cells, macrophages, and T cells .

Oncogenic Implications

Cancer TypeKey FindingsSource
Gastric CancerTMEM41A knockdown reduces cell migration by 40–60%; overexpression enhances pseudopodia formation .
Endometrial CancerOverexpression correlates with advanced TNM stages (OR: 3.2), poor survival (HR: 1.13), and immune microenvironment dysregulation .
Breast CancerHigh TMEM41A expression predicts poor prognosis (HR: 1.13, 95% CI: 1.04–1.24) and immune infiltration .

Mechanistic Insights

  • Cytoskeletal Dynamics: TMEM41A overexpression disrupts actin filament organization, enabling membrane ruffling and metastasis .

  • Diagnostic Potential: ROC analysis in endometrial cancer shows an AUC of 0.667, indicating moderate diagnostic utility .

Clinical and Therapeutic Relevance

  • Prognostic Biomarker: Validated in TCGA datasets as an independent risk factor for survival in multiple cancers .

  • Therapeutic Target: siRNA-mediated knockdown reduces migration and autophagy in cancer cells, suggesting therapeutic potential .

Future Directions

  • Functional Studies: Clarify TMEM41A’s role in RNA modification and immune evasion .

  • Preclinical Trials: Evaluate inhibitors in xenograft models to assess metastasis suppression .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery estimates, please contact your local distributor.
Note: Our proteins are shipped standard with blue ice packs. If dry ice shipping is required, please inform us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag requirement, please specify it in advance, and we will prioritize development of the specified tag.
Synonyms
TMEM41A; UNQ168/PRO194; Transmembrane protein 41A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
18-264
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
TMEM41A
Target Protein Sequence
LYLLSTRLPRGRRLGSTEEAGGRSLWFPSDLAELRELSEVLREYRKEHQAYVFLLFCGAY LYKQGFAIPGSSFLNVLAGALFGPWLGLLLCCVLTSVGATCCYLLSSIFGKQLVVSYFPD KVALLQRKVEENRNSLFFFLLFLRLFPMTPNWFLNLSAPILNIPIVQFFFSVLIGLIPYN FICVQTGSILSTLTSLDALFSWDTVFKLLAIAMVALIPGTLIKKFSQKHLQLNETSTANH IHSRKDT
Uniprot No.

Target Background

Gene References Into Functions
  1. This study demonstrated reduced TMEM41A expression levels in a pair of GC cell lines. Additionally, it revealed that high TMEM41A expression levels may promote GC-associated metastasis, potentially mediated by the downregulation of E-cadherin expression. PMID: 30015937
Database Links

HGNC: 30544

KEGG: hsa:90407

STRING: 9606.ENSP00000406885

UniGene: Hs.677570

Protein Families
TMEM41 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TMEM41A and what are its basic functions?

TMEM41A (Transmembrane Protein 41A) is a protein-coding gene that produces a multi-pass membrane protein. While its complete functional characterization is still evolving, recent studies have identified TMEM41A as playing significant roles in cellular processes including autophagy regulation and epithelial-mesenchymal transition (EMT). The protein has gained particular attention in cancer research due to its aberrant expression in several malignancies. Expression analysis based on TCGA data has confirmed that TMEM41A is frequently overexpressed in cancer tissues compared to normal tissues, suggesting its potential oncogenic functions .

How is TMEM41A expression typically measured in research settings?

TMEM41A expression is commonly assessed using several complementary techniques:

  • Transcriptome analysis: RNA sequencing or microarray data from databases such as TCGA (The Cancer Genome Atlas) provide FPKM (Fragments Per Kilobase Million) values that quantify TMEM41A expression levels across tissues .

  • Quantitative PCR (qPCR): For targeted validation of TMEM41A expression in experimental settings.

  • Immunohistochemistry (IHC): Used to assess protein-level expression in tissue samples and to determine cellular localization patterns.

  • Western blotting: For semi-quantitative protein expression analysis in cell lines and tissue samples.

Research protocols typically include statistical analyses to determine differential expression between normal and disease tissues, often using unpaired and paired samples to strengthen findings .

What cancer types have been associated with altered TMEM41A expression?

Several cancer types demonstrate altered TMEM41A expression patterns:

  • Endometrial carcinoma (EC): TMEM41A is significantly overexpressed in EC tissues compared to normal endometrial tissues, as demonstrated by both non-paired and paired tissue analysis .

  • Gastric cancer: TMEM41A expression has been associated with lymph node metastasis, distant metastasis, and poor prognosis in patients .

  • Colorectal cancer: Studies have shown that SPRING1 enhances colorectal cancer cell growth by promoting TMEM41A expression .

These associations suggest TMEM41A may serve as a valuable diagnostic biomarker across multiple cancer types, with ROC analysis demonstrating diagnostic value (AUC = 0.667 for EC) .

How does TMEM41A expression correlate with clinical parameters in cancer patients?

TMEM41A expression shows significant correlations with multiple clinical parameters, particularly in endometrial carcinoma:

Clinical ParameterTMEM41A Expression PatternStatistical Significance
Clinical stageHigher in stages II-IV compared to stage Ip < 0.001
AgeHigher in patients >60 yearsp < 0.001
WeightHigher in patients >80 kgp = 0.001
Histological typeHigher in mixed and serous subtypes vs. endometrioidp < 0.001
Histologic gradeHigher in G2-G3 vs. G1p < 0.001
Survival statusHigher in deceased patientsp < 0.001

The multivariate analysis further confirms TMEM41A overexpression as an independent prognostic factor, indicating its potential utility in clinical risk stratification .

What are the molecular mechanisms through which TMEM41A influences cancer progression?

The molecular mechanisms of TMEM41A in cancer progression involve multiple pathways:

  • Epithelial-Mesenchymal Transition (EMT): TMEM41A has been shown to regulate EMT in gastric cancer, contributing to increased metastatic potential .

  • Autophagy modulation: Inhibition of TMEM41A expression can delay cancer cell metastasis by regulating autophagy pathways .

  • Immune microenvironment regulation: TMEM41A overexpression significantly correlates with altered immune and stromal scores in tumor tissues. Specifically, it associates with levels of macrophages, CD8+ T cells, T follicular helper cells (TFH), Th2 cells, activated dendritic cells (aDC), and other immune cell populations critical to tumor progression .

  • RNA modifications: TMEM41A expression correlates with RNA modification patterns, suggesting epigenetic regulatory functions .

These mechanisms collectively contribute to the oncogenic role of TMEM41A, making it a potential therapeutic target for cancer treatment.

How does TMEM41A overexpression specifically modify the tumor immune microenvironment?

TMEM41A overexpression exhibits significant associations with the tumor immune microenvironment in multiple dimensions:

  • Immune infiltration: TMEM41A overexpression correlates with altered levels of 17 different immune cell types, including macrophages, CD8+ T cells, T follicular helper cells (TFH), Th2 cells, NK CD56bright cells, NK CD56dim cells, NK cells, plasmacytoid dendritic cells (pDC), T cells, Th17 cells, and regulatory T cells (TReg) .

  • Stromal and immune scores: Higher TMEM41A expression positively correlates with increased stromal, immune, and estimate scores in cancer samples, indicating comprehensive modification of the tumor microenvironment .

  • Immune cell markers: TMEM41A overexpression significantly associates with expression levels of key immune cell markers, including CD8A, CD3D, CD3E, CD2, CSF1R, IL10, IRF5, ITGAM, and CCR7, suggesting functional interactions with these immune components .

These findings suggest TMEM41A may serve as an important mediator between cancer cells and the immune system, potentially influencing immunotherapy responses.

What are the recommended methods for studying TMEM41A expression in patient samples?

For comprehensive analysis of TMEM41A expression in patient samples, researchers should employ a multi-method approach:

  • Transcriptome analysis:

    • RNA-seq data analysis from repositories like TCGA

    • Expression analysis comparing tumor vs. normal tissue in both paired and unpaired samples

    • FPKM normalization for accurate quantification

  • Protein expression analysis:

    • Immunohistochemistry on tissue microarrays

    • Western blotting with validated antibodies

    • Flow cytometry for cellular distribution patterns

  • Statistical validation:

    • ROC analysis to determine diagnostic value (AUC)

    • Pearson or Spearman correlation to associate with clinical parameters

    • Kaplan-Meier survival analysis with log-rank tests to evaluate prognostic value

    • Cox regression analysis to identify independent prognostic factors

When analyzing TMEM41A as a biomarker, researchers should stratify patients by median expression levels to create high- and low-expression groups for meaningful clinical correlations .

What experimental approaches are effective for studying TMEM41A function in cellular models?

To investigate TMEM41A function in cellular models, researchers should consider these approaches:

  • Gene expression modulation:

    • CRISPR/Cas9-mediated knockout to eliminate TMEM41A expression

    • siRNA or shRNA for transient or stable knockdown

    • Overexpression vectors for gain-of-function studies

  • Functional assays:

    • Proliferation assays (MTT, CCK-8, BrdU incorporation)

    • Migration and invasion assays (Transwell, wound healing)

    • Colony formation assays

    • Apoptosis detection (Annexin V/PI staining)

    • Cell cycle analysis (flow cytometry)

  • Mechanism investigation:

    • Autophagy flux monitoring (LC3 conversion, p62 accumulation)

    • EMT marker assessment (E-cadherin, N-cadherin, vimentin)

    • Signaling pathway analysis (Western blotting for PKM2/PI3K/AKT or mTOR/4EBP1 pathways, similar to studies on other oncogenes in EC)

  • Co-immunoprecipitation to identify protein-protein interactions involving TMEM41A

These methods should be applied in relevant cell line models that naturally express TMEM41A or are derived from cancers where TMEM41A plays a significant role, such as endometrial cancer cell lines.

How can TMEM41A expression be integrated into prognostic models for cancer patients?

TMEM41A expression can be effectively integrated into prognostic models through these approaches:

  • Nomogram development:

    • Incorporate TMEM41A expression levels with established clinical factors (clinical stage, age, tumor grade, radiotherapy status)

    • Construct nomograms to predict 1-year, 3-year, and 5-year survival probabilities

    • Validate with calibration curves and concordance index (C-index)

  • Subgroup analysis:

    • Stratify patients by clinical stages, age groups, weight categories, histological subtypes, and tumor grades

    • Perform survival analysis within each subgroup to identify specific patient populations where TMEM41A has strongest prognostic value

  • Multivariate Cox regression:

    • Include TMEM41A expression alongside standard clinicopathological factors

    • Calculate hazard ratios to quantify relative risk associated with TMEM41A overexpression

    • Determine if TMEM41A is an independent prognostic factor

Research shows TMEM41A overexpression is particularly prognostic in patients with stage I-III disease, weight ≤80kg or >80kg, G2-3 grade tumors, endometrioid histology, and those not receiving radiotherapy .

What methodological challenges exist in studying TMEM41A as a biomarker or therapeutic target?

Several methodological challenges must be addressed when studying TMEM41A:

  • Expression heterogeneity:

    • TMEM41A expression varies across cancer subtypes

    • Intratumoral heterogeneity may affect sampling accuracy

    • Need for standardized cutoff values to define "high" versus "low" expression

  • Functional redundancy:

    • TMEM41A belongs to a family of transmembrane proteins

    • Compensatory mechanisms may exist when TMEM41A is targeted

    • Need to assess effects on related family members when manipulating TMEM41A

  • Technical considerations:

    • Antibody specificity challenges for protein detection

    • RNA-protein correlation discrepancies

    • Cross-reactivity concerns with other TMEM family proteins

  • Translational barriers:

    • Need for validated companion diagnostics before clinical application

    • Requirement for prospective studies to confirm retrospective findings

    • Integration with existing biomarker panels rather than standalone use

  • Therapeutic development:

    • Determining optimal methods for targeting a transmembrane protein

    • Specificity of targeting to minimize off-target effects

    • Selection of appropriate patient populations for clinical trials

Addressing these challenges requires rigorous validation across multiple patient cohorts and experimental models.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.