Recombinant Human Transmembrane protein 41B (TMEM41B)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize its development.
Synonyms
TMEM41B; KIAA0033; Transmembrane protein 41B; Protein stasimon
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMEM41B
Target Protein Sequence
MAKGRVAERSQLGAHHTTPVGDGAAGTRGLAAPGSRDHQKEKSWVEAGSARMSLLILVSI FLSAAFVMFLVYKNFPQLSEEERVNMKVPRDMDDAKALGKVLSKYKDTFYVQVLVAYFAT YIFLQTFAIPGSIFLSILSGFLYPFPLALFLVCLCSGLGASFCYMLSYLVGRPVVYKYLT EKAVKWSQQVERHREHLINYIIFLRITPFLPNWFINITSPVINVPLKVFFIGTFLGVAPP SFVAIKAGTTLYQLTTAGEAVSWNSIFILMILAVLSILPAIFQKKLKQKFE
Uniprot No.

Target Background

Function
Transmembrane protein 41B (TMEM41B) is a phospholipid scramblase involved in lipid homeostasis and membrane dynamics. It exhibits phospholipid scramblase activity toward cholesterol, phosphatidylserine, phosphatidylethanolamine, and phosphatidylcholine. TMEM41B plays a crucial role in autophagosome formation, participating in the early stages of autophagosome biogenesis at the endoplasmic reticulum (ER) membrane by rebalancing the ER leaflets as lipids are extracted by ATG2 (ATG2A or ATG2B). This process facilitates autophagosome assembly. Beyond autophagy, TMEM41B is involved in other processes requiring phospholipid scramblase activity. It is essential for normal motor neuron development.
Regarding microbial infection, TMEM41B serves as a critical host factor for infection by human coronaviruses such as SARS-CoV-2, HCoV-OC43, HCoV-NL63, and HCoV-229E, as well as all tested flaviviruses including Zika virus and Yellow fever virus. Following viral entry, TMEM41B facilitates ER membrane remodeling necessary for the formation of replication organelles.
Database Links

HGNC: 28948

KEGG: hsa:440026

STRING: 9606.ENSP00000299596

UniGene: Hs.594563

Protein Families
TMEM41 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Endomembrane system.; Cytoplasm.

Q&A

What is the cellular localization and basic structure of TMEM41B?

TMEM41B is an endoplasmic reticulum (ER)-resident multiple-spanning membrane protein that functions as a concentration-dependent calcium release channel. The protein consists of multiple transmembrane domains with a molecular weight of approximately 25 kDa on denatured gels, though it appears as significantly larger oligomers on native gels, suggesting that TMEM41B typically exists in multimeric complexes . The protein contains a lysine-rich Golgi-to-ER retrieval motif at its C-terminus that interacts with the COPI complex, facilitating its retention in the ER . Several critical aspartate residues (particularly D91/93/94) facing the ER lumen appear to be functionally important for its calcium channel activity, though single amino acid mutations do not completely abolish function . The protein's structure supports its dual function as both a calcium channel and a phospholipid scramblase.

What are the known physiological functions of TMEM41B?

TMEM41B serves several critical physiological functions in cells, with its primary role being that of an endoplasmic reticulum Ca2+ release channel that prevents ER Ca2+ overload . This calcium regulation function is essential for maintaining metabolic quiescence in naive T cells, as demonstrated by the finding that TMEM41B-deficient T cells show increased ER Ca2+ levels and metabolic hyperactivation despite remaining immunologically naive . Beyond calcium regulation, TMEM41B exhibits phospholipid scramblase activity, regulating lipid metabolism and membrane dynamics that are crucial for autophagosome formation . Additionally, TMEM41B functions as an interferon-stimulated gene (ISG), suggesting a role in the innate immune response against viral infections . The protein's broad expression across various tissues indicates that TMEM41B-mediated ER Ca2+ release likely plays important roles in multiple physiological contexts beyond the immune system .

How does TMEM41B contribute to autophagy regulation?

TMEM41B was initially identified through genome-wide CRISPR screens as a critical regulator of autophagy, acting as an ER-resident membrane protein essential for autophagosome formation . The protein facilitates autophagosome biogenesis through its phospholipid scramblase activity, which allows for the bidirectional movement of phospholipids across the ER membrane bilayer . This lipid mobilization function is crucial for membrane expansion during autophagosome formation and proper autophagic flux. TMEM41B coordinates with VMP1 (another ER protein) in regulating autophagy, though they appear to serve distinct functions, as TMEM41B-deficient T cells do not exhibit the mitochondrial Ca2+ overload seen in VMP1-deficient T cells . Research methods to study TMEM41B's role in autophagy typically involve monitoring autophagosome formation using fluorescent markers (LC3-GFP), assessing autophagic flux with lysosomal inhibitors, and examining the localization of autophagy-related proteins in TMEM41B-deficient or overexpressing cells.

What role does TMEM41B play in viral infections?

TMEM41B has been identified as a critical host factor for multiple viral infections, including flaviviruses, coronaviruses (including SARS-CoV-2), and pseudorabies virus (PRV) . For PRV infections specifically, TMEM41B functions as an interferon-stimulated gene that paradoxically promotes viral entry and replication by regulating lipid synthesis . TMEM41B knockdown has been shown to suppress PRV proliferation, while its overexpression enhances viral replication . Mechanistically, TMEM41B influences viral entry by affecting the dynamics of lipid-regulated clathrin-coated pits (CCPs), with lipid replenishment restoring viral entry in TMEM41B-knockdown cells . This lipid regulatory function appears to be a common mechanism through which TMEM41B influences various viral infections, as proper membrane composition and dynamics are essential for viral entry, replication compartment formation, and virion assembly. Research approaches studying this aspect typically involve viral infection assays with TMEM41B-modified cells, quantification of viral titers, and analysis of lipid profiles and membrane dynamics.

What are the optimal methodologies for studying TMEM41B's calcium channel activity?

Investigating TMEM41B's function as a calcium channel requires specialized techniques that directly measure calcium transport and channel properties. Single-channel electrophysiology using purified recombinant TMEM41B reconstituted in planar lipid bilayers represents the gold standard for characterizing channel conductance, ion selectivity, and gating properties . This approach has revealed that TMEM41B forms a cation-selective channel with a conductance of approximately 37.18 ± 7.33 pS and significant selectivity for Ca2+ ions . To measure ER calcium levels in cellular systems, researchers should utilize ER-targeted calcium sensors such as G-CEPIA1er, which allow for direct monitoring of steady-state ER Ca2+ levels and Ca2+ release dynamics in response to stimuli or TMEM41B manipulation . Store-operated calcium entry (SOCE) assays, using fluorescent calcium indicators combined with thapsigargin treatment, provide complementary information about the functional consequences of altered ER calcium handling due to TMEM41B activity . For protein-level studies, site-directed mutagenesis of key residues (particularly D91/93/94) followed by functional reconstitution assays offers insights into the structural determinants of TMEM41B's channel function .

How can researchers effectively manipulate TMEM41B expression and localization for functional studies?

Developing effective strategies for manipulating TMEM41B expression and localization is essential for studying its function in different cellular contexts. For knockout studies, CRISPR-Cas9 gene editing offers precise disruption of TMEM41B, while conditional knockout models (such as the Cd4Cre-Tmem41bfl/fl mouse model) allow for tissue-specific deletion to investigate cell type-specific functions . RNA interference using siRNA or shRNA provides a complementary approach for transient knockdown studies. For overexpression experiments, researchers should consider expression vectors with tunable promoters to control expression levels, as TMEM41B overexpression leads to near-complete depletion of ER Ca2+, which may confound interpretation of results . To manipulate protein localization, the C-terminal lysine-rich Golgi-to-ER retrieval motif can be mutated (TMEM41B-K4A) to redirect the protein to the plasma membrane, enabling more accessible electrophysiological studies . Fusion with fluorescent proteins (such as GFP or mCherry) facilitates visualization of TMEM41B localization and trafficking, though care must be taken to ensure that tags do not interfere with protein function. For temporal control of expression, inducible systems like Tet-On/Off provide valuable tools to study acute versus chronic effects of TMEM41B manipulation.

What experimental approaches are most effective for investigating TMEM41B's role in lipid metabolism?

TMEM41B's phospholipid scramblase activity and its influence on lipid metabolism require specialized techniques for comprehensive investigation. Lipidomic analysis using mass spectrometry represents a gold standard approach for profiling changes in the lipidome resulting from TMEM41B manipulation, allowing for the identification of specific lipid species affected by TMEM41B activity . To directly assess phospholipid scrambling activity, researchers can utilize fluorescently labeled phospholipids and measure their translocation across membranes in reconstituted liposomes containing purified TMEM41B . For cellular studies, lipid synthesis pathway analysis should include quantitative PCR and western blotting to measure expression levels of key lipogenic enzymes in response to TMEM41B manipulation . Fluorescence microscopy with lipid-specific dyes (such as BODIPY for neutral lipids or fluorescent ceramide analogs) enables visualization of lipid distribution and trafficking in living cells. Functional complementation experiments, where specific lipids are supplemented to TMEM41B-deficient cells, can reveal which lipid species are critical for TMEM41B-dependent cellular functions, as demonstrated by the restoration of clathrin-coated pit dynamics and viral entry with lipid replenishment in TMEM41B knockdown cells .

How does TMEM41B deficiency affect T cell metabolism and function, and what are the best methods to study these effects?

TMEM41B deficiency propels naive T cells into a unique state of metabolic activation while maintaining immunological naivety, creating an experimental model to study the decoupling of metabolic and immunological activation . To comprehensively investigate this phenomenon, researchers should employ multiparametric flow cytometry to assess both classical T cell activation markers (CD69, CD25) and metabolic indicators (cell size, mitochondrial mass using MitoTracker dyes) . Metabolic flux analysis using Seahorse technology provides direct measurement of oxygen consumption rate (OCR) and extracellular acidification rate (ECAR), which are significantly elevated in TMEM41B-deficient naive T cells . RNA sequencing and proteomics offer unbiased approaches to identify transcriptional and translational changes associated with this unique metabolic state, revealing upregulation of immediate early genes (Fos, Jun, Myc) and mitochondrial genes without classical activation markers . For functional assessments, T cell receptor stimulation assays using varying antigen concentrations can reveal the heightened responsiveness of TMEM41B-deficient T cells, particularly at suboptimal antigen doses . In vivo infection models (such as LCMV Armstrong or Listeria monocytogenes-OVA) enable evaluation of antigen-specific T cell responses in the context of TMEM41B deficiency, demonstrating their enhanced capacity to respond to pathogens .

What is the relationship between TMEM41B and interferon signaling, and how can this be investigated experimentally?

The discovery that TMEM41B functions as an interferon-stimulated gene (ISG) opens important questions about its role in antiviral immunity and interferon signaling pathways . To investigate this relationship, researchers should first confirm interferon inducibility through qRT-PCR and western blot analysis of TMEM41B expression following treatment with type I (IFNα/β), type II (IFNγ), and type III (IFNλ) interferons at different concentrations and time points . Promoter analysis of the TMEM41B gene can identify potential interferon-stimulated response elements (ISREs) and interferon-gamma activated sequences (GAS), while chromatin immunoprecipitation (ChIP) assays can confirm binding of relevant transcription factors (IRFs, STAT1/2) to these regulatory regions . Reporter gene assays using the TMEM41B promoter can further validate its direct regulation by interferon signaling. Functionally, the role of TMEM41B in interferon-mediated antiviral responses can be assessed by examining viral replication in TMEM41B-deficient cells with and without interferon pretreatment, as well as measuring interferon-stimulated gene expression to determine if TMEM41B influences the broader interferon response . For mechanistic insights, co-immunoprecipitation and proximity labeling approaches can identify protein-protein interactions between TMEM41B and components of interferon signaling pathways or other ISGs.

What are the most effective CRISPR-Cas9 strategies for TMEM41B knockout and knock-in models?

Developing effective CRISPR-Cas9 approaches for TMEM41B manipulation requires careful consideration of guide RNA design, delivery methods, and validation strategies. For complete knockout studies, guide RNAs targeting early exons (particularly exons 2-4) of TMEM41B are preferable to ensure loss of all functional domains . Multiple guide RNAs should be designed and tested in parallel to identify those with highest editing efficiency and minimal off-target effects, with in silico prediction tools like CRISPOR or CHOPCHOP aiding selection. For delivery in established cell lines, lentiviral or plasmid-based transfection systems work well, while electroporation may be preferable for primary T cells . To generate conditional knockout models, as demonstrated with the Cd4Cre-Tmem41bfl/fl mice, the creation of a floxed allele requires precise placement of loxP sites flanking critical exons without disrupting regulatory elements . For knock-in approaches to introduce point mutations (such as the D91/93/94A mutations) or fluorescent tags, homology-directed repair templates with approximately 500-800bp homology arms are recommended . Rigorous validation of edited cells or animals should include genomic PCR, sequencing, RT-PCR, western blotting, and functional assays specific to TMEM41B, such as ER calcium measurements using G-CEPIA1er sensors or lipid scrambling assays .

What are the optimal conditions for measuring TMEM41B-mediated calcium dynamics in different cell types?

Accurately measuring TMEM41B-mediated calcium dynamics requires tailored approaches for different cell types and subcellular compartments. For ER calcium measurements, genetically encoded calcium indicators targeted to the ER lumen, such as G-CEPIA1er, provide direct visualization of ER calcium levels in living cells . These sensors should be stably expressed at moderate levels to avoid perturbation of ER function, with calibration using known ER calcium modulators like thapsigargin . Cytosolic calcium measurements can be performed using either ratiometric dyes (Fura-2) or single-wavelength indicators (Fluo-4), with ratiometric imaging preferred for quantitative studies as it corrects for variations in dye loading and cell thickness . For T cells specifically, crosslinking of CD3 provides a physiological stimulus to trigger calcium release from ER stores and subsequent store-operated calcium entry, which is partially impaired in TMEM41B-deficient cells . Time-lapse imaging with sampling rates of at least 1 frame per second captures rapid calcium dynamics, while longer recordings (10-20 minutes) may be necessary to observe differences in sustained calcium responses. Temperature control is critical, as calcium channel kinetics are temperature-dependent, with measurements ideally performed at physiological temperature (37°C) rather than room temperature . For comparing different experimental conditions, normalized calcium levels (F/F0) and area under curve calculations provide robust quantitative measures of calcium dynamics.

How to effectively analyze the impact of TMEM41B on autophagy pathways?

Comprehensive analysis of TMEM41B's role in autophagy requires multiple complementary approaches to assess different stages of the autophagic process. Autophagosome formation can be monitored using LC3-GFP puncta formation assays, with both basal and starvation-induced autophagy examined in TMEM41B-manipulated cells . Autophagic flux, representing the complete process from autophagosome formation to lysosomal degradation, should be assessed by comparing LC3-II levels with and without lysosomal inhibitors (bafilomycin A1 or chloroquine) via western blotting . Electron microscopy provides ultrastructural evidence of autophagosome formation defects, revealing accumulation of abnormal structures in TMEM41B-deficient cells . For high-throughput screening, automated image analysis of LC3 puncta or flow cytometry-based approaches using tandem fluorescent-tagged LC3 (mRFP-GFP-LC3) can quantify both autophagosome formation and maturation. Co-localization studies with markers for phagophore formation sites (DFCP1, ATG9) can reveal at which stage TMEM41B functions in the autophagy pathway . Considering TMEM41B's role in lipid metabolism, combined analysis of phospholipid dynamics and autophagosome formation using fluorescent lipid probes alongside autophagy markers provides mechanistic insights into how TMEM41B coordinates these processes .

What specialized techniques are required for studying TMEM41B in viral infection models?

Investigating TMEM41B's role in viral infections requires specialized techniques spanning virology, cell biology, and biochemistry. Viral entry assays using pseudotyped viruses or fluorescently labeled viral particles enable detailed analysis of how TMEM41B affects initial stages of infection . Time-of-addition experiments, where TMEM41B expression is manipulated at different stages of viral infection, help delineate its role in entry versus replication or assembly . For pseudorabies virus (PRV) specifically, plaque assays and qPCR detection of viral genomes provide quantitative measures of viral replication in the context of TMEM41B manipulation . Live-cell imaging of clathrin-coated pit dynamics using fluorescently tagged clathrin light chain reveals how TMEM41B-mediated lipid regulation affects endocytic pathways crucial for viral entry . Lipidomic analyses comparing the cellular lipid composition of wild-type and TMEM41B-deficient cells before and after viral infection identify specific lipid species affected by TMEM41B activity and required for viral replication . Rescue experiments with lipid supplementation or expression of TMEM41B mutants defective in either calcium channel function or lipid scrambling activity can disentangle which molecular functions of TMEM41B are critical for supporting viral infection . For in vivo studies, conditional knockout models (like Cd4Cre-Tmem41bfl/fl mice) infected with viruses such as LCMV allow assessment of how TMEM41B affects antiviral immune responses .

What are the implications of TMEM41B dysfunction in human diseases?

TMEM41B dysfunction has been implicated in several human diseases, highlighting its physiological importance beyond basic cellular functions. Loss of TMEM41B causes spinal muscular atrophy (a neurodegenerative disease) in worms and mice, suggesting a critical role in neuronal health and function . In the liver, deletion of TMEM41B induces nonalcoholic hepatosteatosis in mice, consistent with its role in lipid metabolism regulation . Human genetic studies have identified single nucleotide polymorphisms in TMEM41B associated with susceptibility to viral infections, particularly SARS-CoV-2, indicating potential relevance to COVID-19 pathogenesis and treatment strategies . The altered calcium homeostasis resulting from TMEM41B dysfunction may contribute to various calcium-related pathologies, as dysregulation of ER calcium is implicated in neurodegenerative disorders, cardiovascular diseases, and certain cancers . Given TMEM41B's role in T cell quiescence and heightened responsiveness to infection when deficient, it may also have implications for autoimmune disorders or immunodeficiencies, though direct evidence in human patients is currently limited . Research methods for investigating disease relevance include genetic association studies, tissue-specific expression analysis in patient samples, and functional validation in disease-relevant cell types or animal models.

How might TMEM41B be targeted therapeutically, and what methodologies can assess potential interventions?

TMEM41B's multifunctional nature offers several potential therapeutic avenues that could be explored using diverse methodological approaches. Small molecule modulators of TMEM41B's calcium channel function could be identified through high-throughput screening using calcium-sensitive fluorescent indicators in cells expressing wild-type or mutant TMEM41B . For viral infections where TMEM41B promotes viral replication, targeted inhibition using RNA interference approaches (siRNAs or antisense oligonucleotides) or small molecules that disrupt its lipid scrambling activity could provide antiviral benefits . Conversely, enhancing TMEM41B function might benefit conditions associated with impaired autophagy or lipid metabolism disorders . Structure-based drug design would be facilitated by high-resolution structural information from cryo-electron microscopy or X-ray crystallography studies of purified TMEM41B . Cell-based phenotypic screens using disease-relevant readouts (viral infection, autophagy flux, lipid accumulation) could identify compounds that modulate TMEM41B-dependent processes without necessarily targeting the protein directly . Animal models with tissue-specific TMEM41B manipulation, such as the Cd4Cre-Tmem41bfl/fl mice, provide platforms for testing therapeutic interventions in vivo . For immunological applications, the unique ability of TMEM41B deficiency to enhance T cell responsiveness without spontaneous activation suggests potential for improved immunotherapies or vaccine strategies through transient TMEM41B modulation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.