Recombinant Human Transmembrane protein 50A (TMEM50A)

Shipped with Ice Packs
In Stock

Description

Production and Quality Control

Key production parameters for commercially available recombinant TMEM50A include:

ParameterDetails
Expression SystemsE. coli, HEK293, CHO, Baculovirus, Yeast
Purification TagsHis6-ABP, variable tags depending on vendor
Purity≥85% (SDS-PAGE/Coomassie)
Storage-20°C in Tris-based buffer with 50% glycerol; avoid freeze-thaw cycles

Suppliers like Novus Biologicals (NBP2-56262PEP) and MyBioSource offer variants for antibody development and functional assays .

Research Applications

Recombinant TMEM50A is critical for:

  • Antibody Development: Used as an immunogen to generate polyclonal antibodies (e.g., ab221553 from Abcam) .

  • Cancer Studies: High TMEM50A expression correlates with late-stage cervical cancer progression, making it a biomarker candidate .

  • Structural Analysis: Predictions suggest alpha-helices, beta-sheets, and membrane localization (plasma membrane/ER) .

Functional Insights from Studies

While TMEM50A’s exact role remains unclear, studies highlight:

  • Oncogenic Potential: Upregulation in cervical cancer tissues linked to poor prognosis .

  • Interaction Networks: Binds C7orf43, a protein of unknown function, suggesting involvement in membrane trafficking or signaling .

  • Splice Variants: Alternative splicing (e.g., exon 2/3/5 deletions) produces isoforms without frame shifts, hinting at functional plasticity .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement in the order notes, and we will prepare it accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery times.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference for your specific needs.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
TMEM50A; SMP1; UNQ386/PRO718; Transmembrane protein 50A; Small membrane protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-157
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
TMEM50A
Target Protein Sequence
MSGFLEGLRCSECIDWGEKRNTIASIAAGVLFFTGWWIIIDAAVIYPTMKDFNHSYHACG VIATIAFLMINAVSNGQVRGDSYSEGCLGQTGARIWLFVGFMLAFGSLIASMWILFGGYV AKEKDIVYPGIAVFFQNAFIFFGGLVFKFGRTEDLWQ
Uniprot No.

Target Background

Database Links

HGNC: 30590

OMIM: 605348

KEGG: hsa:23585

STRING: 9606.ENSP00000363478

UniGene: Hs.705699

Protein Families
UPF0220 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the genomic location and basic structure of TMEM50A?

TMEM50A is a protein-coding gene located on chromosome 1p36.11 in humans, specifically positioned between the RHD and RHCE genes in the RH gene locus. The gene's mRNA sequence spans 2284 base pairs and includes seven exons, with the coding sequence extending from base pairs 151 to 624 . The resulting protein consists of 157 amino acids with a molecular weight of approximately 17.4 kDa and an isoelectric point of 5.483 .

Structural analysis predicts that TMEM50A contains four transmembrane domains, suggesting its function as an integral membrane protein. These transmembrane regions have been confirmed through comparative analysis with TMEM50A orthologs and by examining the neutral charge in these regions . The protein is most likely localized to either the plasma membrane or the endoplasmic reticulum, as predicted by PSORT II analysis .

How can researchers distinguish between TMEM50A and its related paralogs?

When investigating TMEM50A, researchers should be aware of its important paralog, TMEM50B, which shares structural similarities . To differentiate between these related proteins, researchers should consider:

  • Genomic context: TMEM50A is uniquely positioned between RHD and RHCE genes in the RH locus, which TMEM50B does not share.

  • Molecular characteristics: Compare the specific molecular weight (17.4 kDa) and isoelectric point (5.483) of TMEM50A against those of TMEM50B.

  • Expression patterns: Examine tissue-specific expression profiles to identify differences in distribution patterns.

  • Sequence analysis: Conduct alignment studies to identify unique regions that can be targeted by specific antibodies or primers.

Additionally, other TMEM family members (TMEM217, TMEM120A/B, TMEM60, and TMEM236) have distinct functions and associations that should not be confused with TMEM50A .

What techniques are most effective for modulating TMEM50A expression in experimental settings?

For effective modulation of TMEM50A expression in experimental settings, researchers have successfully employed the following methodologies:

  • Overexpression Systems: Transfection of plasmid DNA containing the TMEM50A coding sequence has been effectively used to upregulate expression. In K562 cell models, this approach significantly increased TMEM50A levels, resulting in a 63.56% upregulation of RHCE gene activity .

  • RNA Interference: siRNA transfection targeting TMEM50A has proven effective for downregulation studies. This approach resulted in significantly decreased expression of both RHCE (41.82%) and RHD (27.35%) .

  • Monitoring Methodology: Western blot and real-time PCR are recommended for detecting expression changes after modulation. These techniques provide both protein-level and transcript-level confirmation of successful TMEM50A manipulation .

When designing these experiments, researchers should include appropriate controls and validate the specificity of their manipulations to ensure observed effects are directly attributable to TMEM50A modulation rather than off-target effects.

What is the tissue distribution pattern of TMEM50A and how might this inform experimental design?

TMEM50A demonstrates a broad tissue distribution pattern that researchers should consider when designing experiments. While comprehensive expression data across all human tissues is still being developed, data from resources such as The Human Protein Atlas indicates expression in multiple tissue types .

When designing experiments, researchers should:

  • Select cell lines or primary cells that naturally express TMEM50A at detectable levels for knockdown studies.

  • For overexpression studies, consider using cell types with naturally low TMEM50A expression to maximize observable effects.

  • Include tissue-specific controls when investigating TMEM50A function in specialized tissues.

  • Consider potential tissue-specific interacting partners that may influence TMEM50A function.

The expression pattern should inform hypothesis generation about physiological functions, particularly in tissues where TMEM50A shows high expression levels or distinctive regulation patterns.

How does TMEM50A influence RH gene expression and what methodology best demonstrates this relationship?

TMEM50A has been demonstrated to significantly influence RH gene expression, with experimental evidence showing bidirectional regulation. The recommended methodology to investigate this relationship includes:

  • Gene Expression Manipulation: Establish experimental systems with both overexpression and knockdown of TMEM50A. In K562 cell models, overexpression significantly up-regulated RHCE gene activity by 63.56%, while inhibition resulted in decreased RHCE (41.82%) and RHD expression (27.35%) .

  • Quantification Methods: Implement real-time PCR for precise quantification of transcript levels and Western blot analysis for protein expression assessment. These complementary approaches provide comprehensive validation of observed effects .

  • Mechanistic Investigation: Transcriptome analysis suggests TMEM50A affects target gene transcription through splicing activities, potentially regulating RH gene expression by affecting mRNA stability . RNA immunoprecipitation (RIP) assays or RNA stability assays could further elucidate this mechanism.

  • Functional Analysis: To assess physiological implications, functional assays such as NH₄⁺ transport monitoring using pH-sensitive dyes can determine whether TMEM50A-mediated changes in RH gene expression translate to altered cellular functions .

When designing these experiments, researchers should carefully control for potential confounding variables and include appropriate controls to ensure the specificity of observed effects.

What are the predicted post-translational modifications of TMEM50A and how might they impact function?

Bioinformatic analyses predict several post-translational modifications (PTMs) for TMEM50A that could significantly influence its function and interactions:

  • Phosphorylation Sites: Two serine phosphorylation sites have been predicted at amino acid positions 82 and 84, along with a possible tyrosine phosphorylation site . These modifications likely regulate TMEM50A activity, protein-protein interactions, or subcellular localization.

  • Glycosylation: A potential N-linked glycosylation site has been identified at amino acid position 74 . Glycosylation could affect protein folding, stability, and recognition by other proteins or receptors.

To experimentally validate and characterize these PTMs, researchers should consider:

  • Phospho-specific antibodies for Western blot analysis

  • Mass spectrometry for comprehensive PTM mapping

  • Site-directed mutagenesis of predicted modification sites to assess functional consequences

  • Treatment with kinase inhibitors or phosphatase inhibitors to modulate phosphorylation status

  • Glycosidase treatment to assess the impact of glycosylation on protein function

Understanding these modifications is crucial for developing a complete model of TMEM50A function, as they may represent key regulatory mechanisms that control the protein's activity under different cellular conditions.

What are the optimal qPCR strategies for studying TMEM50A expression in different experimental settings?

For accurate quantification of TMEM50A expression using qPCR, researchers should consider implementing the following optimized strategies:

  • Dilution-Replicate Design: Instead of using identical replicates at a single concentration, implement a dilution-replicate design where a single reaction is performed at several dilutions for each test sample. This approach allows for simultaneous measurement of PCR efficiency and template quantity, resulting in more reliable results with fewer reactions .

  • Appropriate Dilution Range: Use a multi-level dilution series (e.g., 2-, 10-, and 50-fold; or 5-, 50-, and 500-fold) to ensure accuracy across the dynamic range. Be cautious with extreme dilutions (>500-fold), as these may deviate from linearity and reduce accuracy .

  • Efficiency Calculation: Calculate PCR efficiency from the slope of the semi-log plot of Cq versus log(dilution factor), where the slope equals -1/log(E). This efficiency value should be used for accurate quantification rather than assuming 100% efficiency .

  • Reference Gene Selection: Carefully select appropriate reference genes that maintain stable expression under your experimental conditions. For TMEM50A studies, evaluate common reference genes such as GAPDH or RPS16 to identify those with minimal variation .

  • Primer Design Considerations: Design primers spanning exon-exon junctions to prevent amplification of genomic DNA. Validate primer specificity through melt curve analysis and confirm amplicon size on an agarose gel.

This optimized approach provides several advantages over traditional qPCR methods, including more accurate efficiency calculation, ability to identify and exclude outliers, and reduced reaction numbers while maintaining or improving data quality.

What cellular models are most appropriate for investigating TMEM50A function?

Based on current research, the following cellular models are recommended for investigating TMEM50A function:

  • K562 Cells: This erythroleukemia cell line has been successfully used in TMEM50A research, particularly for studying the relationship between TMEM50A and RH gene expression. K562 cells provide a suitable model for transfection studies and expression regulation experiments .

  • Primary Erythroid Cells: Given TMEM50A's location in the RH gene locus and its effect on RH gene expression, primary erythroid cells represent a physiologically relevant model for studying TMEM50A's native function.

  • Neural Cell Models: Transcriptome analysis suggests TMEM50A plays a role in embryonic nervous system development . Therefore, neural progenitor cells or neuronal differentiation models may be valuable for studying TMEM50A's role in neural development.

  • Zebrafish Models: The zebrafish ortholog of TMEM50A has been characterized and may be involved in late endosome to vacuole transport . Zebrafish embryos can serve as an in vivo model for studying developmental roles of TMEM50A.

When selecting a model system, researchers should consider:

  • The specific aspect of TMEM50A function being investigated

  • Expression levels of TMEM50A in the model system

  • Availability of genetic manipulation tools for the model

  • Relevance to the physiological or pathological context of interest

How can researchers investigate the potential role of TMEM50A in embryonic nervous system development?

Investigating TMEM50A's role in embryonic nervous system development requires a multi-faceted approach:

  • Temporal Expression Analysis: Characterize TMEM50A expression patterns during different stages of neural development using quantitative PCR, in situ hybridization, and immunohistochemistry. Focus on critical developmental timepoints to identify potential windows of functional significance.

  • Loss-of-Function Studies: Implement CRISPR/Cas9-mediated knockout or knockdown strategies in neural progenitor cells, followed by differentiation assays to assess:

    • Neural progenitor proliferation rates

    • Lineage commitment decisions

    • Neurite outgrowth and axonal pathfinding

    • Synaptogenesis and functional maturation

  • Animal Models: Utilize zebrafish models, where the TMEM50A ortholog has been characterized , to perform in vivo developmental studies. Zebrafish embryos offer advantages including rapid development, transparency, and amenability to genetic manipulation.

  • Interaction Network Analysis: Perform co-immunoprecipitation followed by mass spectrometry to identify TMEM50A-interacting proteins in neural tissues. This can reveal potential signaling pathways through which TMEM50A influences neural development.

  • Transcriptome Analysis: Conduct RNA-seq on control versus TMEM50A-depleted neural progenitors or neurons at different developmental stages to identify genes and pathways affected by TMEM50A manipulation, with particular attention to established neurodevelopmental regulators.

This comprehensive approach will help elucidate whether the suggested role of TMEM50A in embryonic nervous system development represents a primary function or a secondary effect of its activity in other cellular processes.

What is the relationship between TMEM50A polymorphisms and RH haplotypes, and how can this be investigated?

The positional relationship between TMEM50A and RH genes suggests potential linkage between TMEM50A polymorphisms and RH haplotypes, which may contribute to selective pressure affecting these haplotypes . To investigate this relationship, researchers should consider the following approaches:

  • Population Genetics Analysis:

    • Sequence TMEM50A in diverse populations with different RH haplotype distributions

    • Perform linkage disequilibrium analysis between TMEM50A polymorphisms and RH alleles

    • Analyze haplotype blocks to determine the extent of genetic linkage

  • Functional Assessment of Variants:

    • Identify non-synonymous SNPs in TMEM50A that correlate with specific RH haplotypes

    • Create expression constructs with different TMEM50A variants

    • Assess their impact on RH gene expression through transfection studies

    • Measure RHD and RHCE transcript and protein levels using qPCR and Western blotting

  • Evolutionary Analysis:

    • Compare TMEM50A sequences across primates and other mammals with different RH systems

    • Calculate selection coefficients to identify regions under positive selection

    • Correlate evolutionary changes in TMEM50A with changes in RH genes

  • Clinical Correlation Studies:

    • Analyze TMEM50A polymorphisms in patients with RH-related alloimmunization

    • Investigate whether specific TMEM50A variants correlate with altered RH antigen expression

    • Examine potential associations with transfusion reactions or hemolytic disease of the fetus and newborn

This integrative approach would provide insights into whether TMEM50A polymorphisms have contributed to the evolution and diversity of RH haplotypes, potentially revealing new aspects of RH biology relevant to transfusion medicine and maternal-fetal compatibility.

How might TMEM50A research contribute to understanding and addressing Rh-related blood transfusion complications?

TMEM50A research has significant potential implications for Rh-related blood transfusion complications through several mechanisms:

  • Regulation of RH Gene Expression: Studies have demonstrated that TMEM50A significantly influences both RHD and RHCE gene expression. Overexpression of TMEM50A upregulates RHCE activity by 63.56%, while its inhibition decreases RHCE and RHD expression by 41.82% and 27.35%, respectively . This regulatory relationship suggests TMEM50A could serve as a potential target for modulating Rh antigen expression.

  • Predictive Biomarker Development: TMEM50A polymorphisms may be linked to RH haplotypes due to their genomic proximity . By characterizing these relationships, researchers could develop genetic markers that predict Rh phenotypes more accurately than current methods, potentially improving compatibility testing.

  • Understanding Alloimmunization Mechanisms: Investigating how TMEM50A influences Rh antigen presentation on erythrocyte membranes could provide insights into mechanisms of alloimmunization, particularly in cases where standard Rh typing fails to predict immunological responses.

  • Therapeutic Strategies: For specific patient populations with Rh-related complications, targeted modulation of TMEM50A could potentially serve as a novel approach for altering Rh antigen expression, though this would require extensive preclinical development.

Researchers addressing these questions should implement a multidisciplinary approach combining molecular biology, immunology, and clinical hematology perspectives to translate TMEM50A findings into practical applications for transfusion medicine.

What experimental approaches should be used to investigate TMEM50A's potential role in cervical cancer?

To investigate TMEM50A's potential role in cervical cancer, researchers should implement a comprehensive experimental strategy:

  • Expression Analysis in Clinical Samples:

    • Compare TMEM50A mRNA and protein expression between cervical cancer tissues and matched normal tissues using qPCR and immunohistochemistry

    • Correlate expression levels with clinical parameters (stage, grade, patient outcomes)

    • Create a tissue microarray to facilitate high-throughput analysis across multiple samples

  • Functional Studies in Cell Lines:

    • Modulate TMEM50A expression in cervical cancer cell lines (e.g., HeLa, SiHa, C-33A) using:

      • Overexpression via plasmid transfection

      • Knockdown via siRNA or CRISPR/Cas9

    • Assess effects on:

      • Proliferation (MTT/MTS assays, BrdU incorporation)

      • Migration and invasion (wound healing, transwell assays)

      • Apoptosis resistance (Annexin V staining, caspase activity)

      • Response to standard chemotherapeutic agents

  • Mechanistic Investigation:

    • Perform RNA-seq on control versus TMEM50A-modulated cells to identify affected pathways

    • Investigate potential interactions with known cervical cancer drivers (e.g., HPV oncoproteins)

    • Assess impact on RH gene expression, which may have indirect effects on cancer cell behavior

  • In Vivo Models:

    • Establish xenograft models using TMEM50A-overexpressing or TMEM50A-knockout cervical cancer cells

    • Monitor tumor growth, metastasis, and response to therapy

    • Evaluate angiogenesis and tumor microenvironment changes

This systematic approach would help determine whether TMEM50A plays a causal role in cervical cancer pathogenesis or progression, potentially identifying new therapeutic targets or prognostic markers for this malignancy .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.