Recombinant Human Transmembrane protein 50B (TMEM50B)

Shipped with Ice Packs
In Stock

Description

Introduction to TMEM50B

Transmembrane protein 50B (TMEM50B), formerly known as C21orf4, is a developmentally regulated protein implicated in cellular processes such as intracellular membrane trafficking and brain development. It belongs to the transmembrane protein (TMEM) family, which spans biological membranes and regulates diverse cellular functions. TMEM50B is of particular interest due to its overexpression in Down syndrome models and its localization in the endoplasmic reticulum (ER) and Golgi apparatus .

Gene Information

ParameterValue
Gene ID757 (NCBI), ENSG00000142188 (Ensembl)
Chromosomal LocationChromosome 21 (21q22.3)
SynonymsC21orf4, HCV p7-trans-regulated protein 3, UNQ167/PRO193
ParalogTMEM50A
Associated DiseaseImmunodeficiency 28 (OMIM: 617894)
UniProt IDP56557

Protein Features

AttributeDescription
Molecular Weight~17.8 kDa (predicted)
Subcellular LocalizationER and Golgi apparatus membranes
DomainsPredicted transmembrane domains
Expression PatternsBrain (cerebellum, hippocampus), heart, testis; glial cells

Subcellular Localization and Function

TMEM50B is predominantly localized to the endoplasmic reticulum (ER) and Golgi apparatus, as confirmed by electron microscopy and immunohistochemistry . Its role includes:

  • Membrane Trafficking: Predicted involvement in late endosome-to-vacuole transport via multivesicular body sorting .

  • Developmental Regulation: Strong expression in neural precursor cells, glial cells (GFAP+), and Bergmann glia in the cerebellum .

  • Cellular Stress Response: Upregulated in hypoxic conditions (linked to HIF1α in ovarian cancer models) .

Tissue Distribution

TissueExpression LevelCell Type
BrainHighPurkinje cells, Golgi cells, glial cells
HeartModerateCardiomyocytes
TestisModerateGerm cells

Developmental Stages

  • Embryonic Day 14.5: Cortical plate and spinal cord mRNA expression.

  • Postnatal Day 7: Cerebellum, hippocampus, and olfactory bulb dominance .

Down Syndrome and Neurodevelopment

TMEM50B is overexpressed in Ts1Cje mice (Down syndrome model), suggesting a role in cerebellar dysgenesis. Its glial cell-specific expression may contribute to neurodevelopmental deficits .

Cancer and Hypoxia

While TMEM50B is not directly implicated in cancer, its regulation by hypoxia (via HIF1α) and ER/Golgi pathways may intersect with oncogenic processes, such as autophagy or protein quality control .

Research Challenges and Future Directions

  1. Functional Mechanisms: Limited understanding of its role in membrane trafficking and neurodevelopment.

  2. Therapeutic Potential: Exploring TMEM50B as a biomarker for Down syndrome or neurodegenerative diseases.

  3. Structural Studies: High-resolution crystallography to elucidate transmembrane domain interactions .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
TMEM50B; C21orf4; UNQ167/PRO193; Transmembrane protein 50B; HCV p7-trans-regulated protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-158
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
TMEM50B
Target Protein Sequence
MAGFLDNFRWPECECIDWSERRNAVASVVAGILFFTGWWIMIDAAVVYPKPEQLNHAFHT CGVFSTLAFFMINAVSNAQVRGDSYESGCLGRTGARVWLFIGFMLMFGSLIASMWILFGA YVTQNTDVYPGLAVFFQNALIFFSTLIYKFGRTEELWT
Uniprot No.

Target Background

Database Links

HGNC: 1280

OMIM: 617894

KEGG: hsa:757

STRING: 9606.ENSP00000397773

UniGene: Hs.433668

Protein Families
UPF0220 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is TMEM50B and where is it primarily located within cells?

TMEM50B (transmembrane protein 50B), also known as C21orf4 or HCVP7TP3, is a protein-coding gene located on chromosome 21q22.11. The protein is predominantly localized to the endoplasmic reticulum (ER) and Golgi apparatus membranes, as confirmed through electron microscopy studies . Current research indicates TMEM50B is involved in late endosome to vacuole transport via multivesicular body sorting pathway, suggesting its role in cellular trafficking and protein processing . The protein contains multiple transmembrane domains and is highly conserved across mammalian species, with mouse and rat orthologs showing 100% sequence identity in specific regions .

How does TMEM50B expression vary across tissue types?

TMEM50B exhibits tissue-specific expression patterns, with significant presence in neuronal tissues. Quantitative PCR analysis of adult mouse tissue shows TMEM50B mRNA expression predominantly in the brain, heart, and testis . Within the brain, expression patterns change during development. At embryonic day 14.5, expression is observed in the cortical plate and spinal cord, while by postnatal day 7, strong mRNA expression is detected in the cerebellum, hippocampus, and olfactory bulb, with diffuse cortical expression . In adult cerebellum, immunohistochemistry studies have localized TMEM50B to Purkinje and Golgi cell somata and in Bergmann glial processes .

What are the known genetic variants of TMEM50B and their significance?

TMEM50B comprises 11 exons spanning chromosome 21 position 33432486 to 33479974 (complement) . Several genetic variants have been reported in databases including ClinVar and dbVar, though their clinical significance varies. Research has associated TMEM50B variants with cognitive performance, suggesting potential roles in neurological function . The gene has been linked to Down syndrome phenotypes due to its location on chromosome 21 and its significant overexpression during cerebellar development in Down syndrome mouse models . Researchers investigating TMEM50B variants should utilize resources such as the Variation Viewer and ClinVar databases to assess potential functional impacts of specific mutations.

What are the optimal methods for detecting TMEM50B expression in experimental settings?

Detection of TMEM50B can be accomplished through several complementary approaches:

  • mRNA detection: Real-time PCR and in situ hybridization have been successfully employed to characterize TMEM50B expression patterns during development and across tissues . For in situ hybridization, optimal results have been achieved using embryonic day 14.5 and postnatal day 7 samples.

  • Protein detection: Western blot analysis using polyclonal antibodies against TMEM50B has proven effective for protein quantification . When performing immunohistochemistry, researchers should consider using antibodies targeting the immunogen sequence "DAAVVYPKPEQLNHAFHTCG" which has demonstrated specificity in previous studies .

  • Co-localization studies: Double immunofluorescence techniques combining TMEM50B antibodies with markers such as glial fibrillary acidic protein (GFAP), MAP2, or beta-tubulin II can effectively determine cell-type specific expression patterns .

How can recombinant TMEM50B be effectively expressed and purified for functional studies?

For recombinant expression of human TMEM50B:

  • Vector selection: The protein coding region (ORF) of TMEM50B comprises 477 base pairs. Expression vectors such as pcDNA3.1+/C-(K)DYK with C-terminal tags have been successfully employed . Consider using CloneEZ™ Seamless cloning technology for efficient insertion.

  • Expression systems: Due to TMEM50B's localization to ER and Golgi membranes, mammalian expression systems are recommended over bacterial systems to ensure proper protein folding and post-translational modifications.

  • Purification strategies: For membrane proteins like TMEM50B, detergent-based extraction methods are essential. A two-step purification protocol using affinity chromatography followed by size exclusion chromatography has proven effective for related transmembrane proteins.

  • Quality control: Verify proper expression and localization using Western blot and immunocytochemistry. Functional validation through transport assays or binding studies should be conducted to confirm biological activity.

What evidence supports TMEM50B's role in neurodevelopment and potential contribution to Down syndrome phenotypes?

TMEM50B has demonstrated significant associations with neurodevelopment through multiple lines of evidence:

  • Developmental expression patterns: TMEM50B shows developmentally regulated expression in the brain, with specific patterns in the cortical plate and spinal cord at embryonic day 14.5, followed by strong expression in the cerebellum, hippocampus, and olfactory bulb by postnatal day 7 .

  • Down syndrome associations: Tmem50b is significantly overexpressed during cerebellar development in the Ts1Cje Down syndrome mouse model, suggesting potential contributions to Down syndrome-related phenotypes . This overexpression correlates with the gene's location on chromosome 21, which is triplicated in Down syndrome.

  • Cellular localization: TMEM50B shows high expression in glial fibrillary acidic protein-positive cells in vivo and in vitro, with invariable expression in cultured mouse neural precursor cells . This suggests potential roles in glial function and neural progenitor development.

  • Cerebellar expression: In adult mouse cerebellum, TMEM50B is found in Purkinje and Golgi cell somata and in Bergmann glial processes, indicating continued importance in mature neuronal circuits .

These findings collectively suggest TMEM50B may contribute to neurodevelopmental processes through functions associated with precursor cells and glia, potentially influencing correct brain development. The overexpression in Down syndrome models highlights a possible role in the neurological phenotypes associated with this condition.

What is known about TMEM50B's potential involvement in inflammatory bowel disease?

Genetic studies have identified associations between TMEM50B and inflammatory bowel disease (IBD), suggesting its potential role in host-microbe interactions . While the exact mechanisms remain under investigation, several hypotheses have emerged:

  • Genetic architecture: TMEM50B variants have been implicated in host-microbe interactions that shape the genetic architecture of inflammatory bowel disease .

  • Membrane trafficking: Given TMEM50B's involvement in endosomal transport pathways, dysfunction may impact epithelial barrier function or immune cell trafficking relevant to IBD pathogenesis.

  • Cellular response: By affecting membrane protein regulation, TMEM50B may influence cellular responses to inflammatory stimuli or bacterial components.

Researchers investigating TMEM50B's role in IBD should consider employing intestinal epithelial cell models and examining genetic variants in patient populations with well-characterized disease phenotypes.

How might TMEM50B functionally interact with other proteins in the endosomal trafficking pathway?

Based on TMEM50B's predicted involvement in late endosome to vacuole transport via multivesicular body sorting pathway , several experimental approaches can elucidate its protein interactions:

  • Co-immunoprecipitation studies: Using tagged TMEM50B constructs to pull down interacting partners from cellular lysates, followed by mass spectrometry identification.

  • Proximity labeling approaches: Employing BioID or APEX2 fusion proteins to identify proteins in close proximity to TMEM50B within living cells.

  • Functional screening: RNAi or CRISPR screens targeting known endosomal trafficking components can identify genetic interactions with TMEM50B.

  • Live cell imaging: Dual-color fluorescence microscopy using fluorescently tagged TMEM50B and established endosomal markers (Rab5, Rab7, ESCRT components) to track co-localization and temporal dynamics.

These approaches should be conducted in relevant cell types, particularly neuronal or glial cells given TMEM50B's expression pattern, to identify tissue-specific interaction networks.

What experimental approaches can determine if TMEM50B overexpression contributes directly to Down syndrome phenotypes?

To establish causative relationships between TMEM50B overexpression and Down syndrome phenotypes:

  • Conditional transgenic models: Generate mouse models with inducible, tissue-specific TMEM50B overexpression to assess whether isolated overexpression recapitulates specific Down syndrome phenotypes.

  • Rescue experiments: In Down syndrome models, employ RNAi or CRISPR technologies to normalize TMEM50B expression levels and assess phenotypic rescue.

  • Single-cell transcriptomics: Compare gene expression patterns in cells with varying TMEM50B expression levels from Down syndrome models to identify downstream pathways.

  • Primary culture systems: Establish primary neuronal cultures from Down syndrome models and control cells, manipulating TMEM50B expression to assess cellular phenotypes including neurite outgrowth, synapse formation, and electrophysiological properties.

  • Human iPSC models: Derive induced pluripotent stem cells from Down syndrome patients and controls, differentiating them into relevant neural cell types while modulating TMEM50B expression.

The experimental design should include appropriate controls and quantitative metrics for assessing phenotypic changes that correlate with Down syndrome features.

How does post-translational modification affect TMEM50B function?

While specific post-translational modifications (PTMs) of TMEM50B remain under investigation, researchers can explore this question through:

  • Mass spectrometry analysis: Purify TMEM50B from different cellular contexts and perform proteomic analysis to identify phosphorylation, glycosylation, ubiquitination, or other modifications.

  • Site-directed mutagenesis: Based on predicted modification sites, generate mutants that cannot be modified at specific residues and assess functional consequences.

  • Pharmacological approaches: Use inhibitors of specific modification pathways (kinase inhibitors, glycosylation inhibitors) to determine effects on TMEM50B localization and function.

  • Cell state dependence: Compare modifications under different cellular conditions (stress, differentiation, disease models) to identify regulatory patterns.

Given TMEM50B's localization to the ER and Golgi apparatus , glycosylation is likely to be a relevant modification affecting protein folding, stability, and trafficking through the secretory pathway.

What is the relationship between TMEM50B expression and cellular stress responses?

The relationship between TMEM50B and cellular stress responses represents an important research direction:

  • Stress induction experiments: Expose relevant cell types to various stressors (ER stress, oxidative stress, nutrient deprivation) and measure changes in TMEM50B expression and localization.

  • Knockout/knockdown phenotypes: Assess how cells with altered TMEM50B expression respond to stress conditions compared to control cells.

  • Transcriptional regulation: Analyze the TMEM50B promoter region for stress-responsive elements and confirm with reporter assays under various stress conditions.

  • Protection/susceptibility assays: Determine whether TMEM50B overexpression or knockdown affects cell survival during stress, particularly in neuronal cells relevant to Down syndrome pathology.

These approaches will help determine whether TMEM50B plays a protective or detrimental role during cellular stress, which may be particularly relevant to neurodegenerative aspects of Down syndrome.

How conserved is TMEM50B across species and what does this suggest about its functional importance?

TMEM50B shows significant conservation across mammalian species, suggesting functional importance:

SpeciesSequence IdentityGene IDReference
HumanReference757
Mouse/Rat100% (in immunogen region)-
Bactrian camelHigh conservation105070231
Western European hedgehogPresent103110547
Mummichog (fish)Present105916787

The high degree of conservation, particularly in mammals, suggests evolutionary pressure to maintain TMEM50B function. This conservation extends to certain fish species, indicating the protein's ancient evolutionary origins . Comparative genomic studies can further elucidate:

  • Domain conservation: Which protein domains show the highest conservation, suggesting functional importance.

  • Species-specific adaptations: Whether certain lineages show adaptive changes correlating with specific physiological demands.

  • Expression pattern conservation: Whether the tissue-specific expression patterns observed in mice are conserved in other species.

The presence of TMEM50B across diverse vertebrate lineages supports a fundamental cellular function, likely in membrane trafficking pathways that are essential to eukaryotic cells.

How does TMEM50B compare structurally and functionally to TMEM50A?

TMEM50A and TMEM50B represent paralogous genes with distinct functions:

  • Genomic location: While TMEM50B is located on chromosome 21q22.11 , TMEM50A (also known as SMP1) is located on chromosome 1p36.11 in the RH gene locus .

  • Functional associations: TMEM50A appears to regulate RH gene expression by affecting mRNA stability through splicing functions and may play a role in embryonic nervous system development . TMEM50B is involved in late endosome to vacuole transport and shows strong association with neuronal development .

  • Structural comparison: Both proteins contain multiple transmembrane domains, but comparative structural analysis using predictive modeling would help identify conserved functional domains versus divergent regions that may account for their different cellular roles.

  • Expression patterns: While TMEM50B shows strong expression in brain tissues , researchers should compare with TMEM50A expression patterns to identify potential functional overlap or tissue-specific specialization.

Understanding the relationship between these paralogs could provide insights into their evolutionary history and functional divergence, potentially informing therapeutic approaches targeting either protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.