Recombinant Human Transmembrane protein 51 (TMEM51)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Transmembrane Protein 51 (TMEM51)

Transmembrane protein 51 (TMEM51) is a protein-coding gene in humans . It is also known as C1orf72 and FLJ10199 . TMEM51 is located on chromosome 1 at position 1:15152532-15220478 (GRCh38) .

Gene ID and General Information

The gene ID for TMEM51 is 55092, and it was last updated on January 4, 2025 . Open Targets Genetics explores associations between traits, variants, and genes, including TMEM51, with a focus on multi-trait analysis and gene-to-variant scoring .

Role in Laryngeal Squamous Cell Carcinoma (LSCC)

Research indicates that TMEM51 plays a role in laryngeal squamous cell carcinoma (LSCC).

  • lncRNA TMEM51-AS1: Long non-coding RNAs (lncRNAs) like TMEM51-AS1 can function as competing endogenous RNAs (ceRNAs) to interact with microRNAs (miRNAs) to regulate target genes, influencing cancer initiation and progression .

  • CeRNA Network: TMEM51-AS1 functions as a ceRNA to regulate SNX21 (sorting nexin family member 21) and TRAPPC10 (trafficking protein particle complex 10) by sponging miR-106b .

  • Methylation-mediated Upregulation: Methylation-mediated upregulation of lncRNA TMEM51-AS1 may function as a ceRNA for miR-106b to regulate SNX21 and TRAPPC10 .

TMEMs Role in Cell Proliferation, Migration, and EMT in Cancer

TMEMs play a role in cell proliferation, migration, invasion, and epithelial-mesenchymal transition (EMT) in cancer. For example, TMEM119 promotes cancer cell proliferation, migration, and invasion in gastric and ovarian cancers, while also inhibiting apoptosis .

Product Specs

Form
Lyophilized powder Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates. Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing. The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TMEM51; C1orf72; Transmembrane protein 51
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-253
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMEM51
Target Protein Sequence
MMAQSKANGSHYALTAIGLGMLVLGVIMAMWNLVPGFSAAEKPTAQGSNKTEVGGGILKS KTFSVAYVLVGAGVMLLLLSICLSIRDKRKQRQGEDLAHVQHPTGAGPHAQEEDSQEEEE EDEEAASRYYVPSYEEVMNTNYSEARGEEQNPRLSISLPSYESLTGLDETTPTSTRADVE ASPGNPPDRQNSKLAKRLKPLKVRRIKSEKLHLKDFRINLPDKNVPPPSIEPLTPPPQYD EVQEKAPDTRPPD
Uniprot No.

Target Background

Database Links

HGNC: 25488

KEGG: hsa:55092

UniGene: Hs.465305

Subcellular Location
Membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.