Recombinant Human Transmembrane protein 52 (TMEM52)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Transmembrane Protein 52 (TMEM52)

Recombinant human TMEM52 is a synthetic version of the endogenous transmembrane protein encoded by the TMEM52 gene (Gene ID: 339456) located on chromosome 1p36.33 . This protein is characterized by its transmembrane domain structure and a molecular weight of 21.9 kDa . It is primarily expressed in HEK293 cells for research applications, often tagged with a Myc-DYKDDDDK sequence at the C-terminus for detection and purification .

Production and Purification

TMEM52 is produced via recombinant DNA technology in mammalian cell systems (e.g., HEK293) to ensure proper post-translational modifications. Key production parameters include:

ParameterDetails
Expression SystemHEK293 cells
TagMyc-DYKDDDDK (C-terminal)
Purity>80% (SDS-PAGE and Coomassie blue staining)
Buffer25 mM Tris-HCl (pH 7.3), 100 mM glycine, 10% glycerol
Concentration50 μg/mL

The protein is stored at -80°C to maintain stability, with a recommended freeze-thaw cycle limit of 2–3 times .

Applications in Research and Diagnostics

Recombinant TMEM52 serves as a critical tool in:

  • Antibody Production: Serves as a native antigen for generating high-affinity antibodies .

  • ELISA Controls: Used as a standard in immunoassays to validate antibody specificity .

  • Mechanistic Studies: Explored for its role in cell membrane dynamics and signaling pathways .

Limitations:

  • ELISA kits optimized for native TMEM52 may not reliably detect recombinant forms due to structural differences .

Biochemical and Functional Properties

PropertyDetails
Molecular Weight21.9 kDa
Subcellular LocalizationPredicted membrane-associated ; confirmed in HEK293 expression
UniProt IDQ8NDY8

The C-terminal Myc tag facilitates immunoassay detection without interfering with the protein’s native function .

Clinical and Research Relevance

While TMEM52’s endogenous role remains poorly understood, its expression profile in cancer tissues has been preliminarily mapped:

  • Cancer Tissue Expression: Detected in colorectal, breast, prostate, and lung cancers via immunohistochemistry .

  • Potential Biomarker: Further studies are needed to assess its correlation with prognosis or therapeutic response .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a useful reference for customers.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag, please inform us; we will prioritize development to meet your specifications.
Synonyms
TMEM52; UNQ3048/PRO9864; Transmembrane protein 52
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
33-209
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
TMEM52
Target Protein Sequence
FADGSCDPSDQCPPQARWSSLWHVGLILLAVLLLLLCGVTAGCVRFCCLRKQAQAQPHLP PARQPCDVAVIPMDSDSPVHSTVTSYSSVQYPLGMRLPLPFGELDLDSMAPPAYSLYTPE PPPSYDEAVKMAKPREEGPALSQKPSPLLGASGLETTPVPQESGPNTQLPPCSPGAP
Uniprot No.

Target Background

Database Links

HGNC: 27916

KEGG: hsa:339456

UniGene: Hs.123423

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Human TMEM52 and what are its key molecular characteristics?

TMEM52 (Transmembrane protein 52) is a human protein with the following key characteristics:

  • Molecular Weight: Approximately 21.9 kDa

  • Structure: Contains transmembrane domains consistent with its classification as a membrane protein

  • Cellular Localization: Primarily localized to cellular membranes

Unlike the related protein TMEM52B, which has been extensively studied in cancer contexts, the specific molecular function of TMEM52 remains less characterized in current literature .

How is recombinant Human TMEM52 protein typically produced for research applications?

Recombinant Human TMEM52 protein for research is typically produced through the following methodology:

Production ParameterTypical Specifications
Expression SystemHEK293T cells
Vector ElementsC-terminal tags (e.g., Myc/DDK) for detection and purification
Purification MethodAffinity chromatography
Quality ControlSDS-PAGE with Coomassie blue staining
Purity>80% as determined by SDS-PAGE
Storage Buffer25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Storage Conditions-80°C, avoiding repeated freeze-thaw cycles

The expression in mammalian cells such as HEK293T ensures proper folding and post-translational modifications that may be critical for maintaining the biological activity of the protein .

What experimental controls should be included when working with TMEM52 in gene expression studies?

When designing experiments involving TMEM52 gene expression analysis, researchers should implement the following controls:

  • Reference Gene Selection: Avoid using only traditional housekeeping genes like GAPDH and ACTB without validation, as their expression can vary considerably under different experimental conditions. Multiple reference genes should be evaluated for stability in each specific experimental context .

  • RNA Quality Controls: Complete removal of RNA from cDNA samples is essential for obtaining accurate cDNA content used for data normalization .

  • Technical vs. Biological Replicates: Technical replicates confirm experimental accuracy but say nothing about reproducibility from a biological standpoint. Biological replicates help determine changes in expression levels across different cell types or treatment conditions .

  • Positive and Negative Controls: Include both positive and negative controls, as well as proper reference genes along with a robust standard curve for qPCR. Controls help determine relative baseline levels and whether samples have contaminants or non-specific PCR amplification products .

What are the optimal sample preparation methods for TMEM52 protein analysis?

For optimal TMEM52 protein analysis, consider these methodological approaches:

  • Protein Extraction:

    • For membrane proteins like TMEM52, use specialized extraction buffers containing gentle detergents (e.g., CHAPS, NP-40, or Triton X-100)

    • Maintain cold temperatures throughout extraction to prevent degradation

    • Include protease inhibitors to prevent protein degradation

  • Sample Storage:

    • Store at -80°C in buffer containing 10% glycerol to maintain stability

    • Avoid repeated freeze-thaw cycles which can compromise protein integrity

  • Quantification:

    • Use microplate BCA method for accurate concentration determination

    • Account for the presence of detergents when calculating protein concentration

  • Denaturing vs. Native Conditions:

    • For SDS-PAGE analysis, standard denaturing conditions are suitable

    • For functional studies, native conditions preserving protein structure may be preferable

How should experimental design be optimized when studying TMEM52 gene expression in complex biological systems?

When investigating TMEM52 gene expression in complex biological systems, Design of Experiments (DoE) methodology offers significant advantages:

Key DoE Principles for TMEM52 Studies:

  • Randomization: Randomize sample processing to avoid bias in results

  • Replication: Include sufficient biological replicates to increase precision and statistical power

  • Blocking: Implement blocking strategies to reduce variability from known sources

  • Factorial Experimentation: Assess individual and combined factor effects on TMEM52 expression

Specific Considerations for TMEM52 Gene Expression Analysis:

  • Amplicon Design:

    • Design primers that amplify 100 bases rather than 1000 bases for higher efficiency and precision

    • Avoid areas that create secondary structure from DNA self-hybridization after denaturing to improve primer annealing

  • For Limited Samples or Low Abundance TMEM52:

    • Implement two-step RT-qPCR protocols

    • Consider preamplification of RNA or first-strand cDNA to increase detectable target amount

    • These approaches are particularly useful for single-cell analysis, clinical samples, fine needle biopsies, microdissection samples, or FACS-generated cells

  • SNP Positioning Evaluation:

    • Assess SNP positioning to avoid issues with previously unidentified SNPs that can affect primer and probe annealing

    • Utilize databases like Ensembl to obtain transcript variant and exon organization data for optimal assay design

  • For Low Abundance Detection:

    • Consider digital PCR instead of qPCR as it provides absolute counting without requiring comparison to standard curves, increasing accuracy for low expression levels

What is known about the relationship between TMEM52 and TMEM52B, and how might their functions differ?

While TMEM52 and TMEM52B are both transmembrane proteins, current research suggests significant functional differences:

CharacteristicTMEM52TMEM52B
FunctionLess characterized; no definitive molecular function established in current literature Promotes tumor progression and metastasis, particularly in nasopharyngeal carcinoma
IsoformsSingle characterized formTwo primary isoforms: P18 and P20 with different subcellular localizations and functions
Clinical SignificanceLimited clinical associations establishedAssociated with advanced tumor stage, recurrence, and decreased survival time in NPC patients
Mechanistic UnderstandingLimited mechanistic data availableCytoplasmic TMEM52B promotes AKT phosphorylation by interacting with PGK1; membrane-localized TMEM52B-P20 promotes E-cadherin ubiquitination

TMEM52B has been identified as an independent risk factor for survival in NPC patients (HR 8.840, 95% CI 2.029-38.511, p=0.004) . The differential regulation of cellular processes by TMEM52B isoforms suggests that related proteins like TMEM52 may also exhibit context-specific functions depending on cellular localization and binding partners.

How do environmental and chemical exposures affect TMEM52 expression patterns?

TMEM52 expression appears responsive to various chemical exposures based on experimental evidence:

Chemicals Decreasing TMEM52 Expression:

  • 1,2-dimethylhydrazine

  • 2,3,7,8-tetrachlorodibenzodioxine

  • Alpha-Zearalanol

Chemicals Increasing TMEM52 Expression:

  • 4-hydroxyphenyl retinamide (fenretinide)

  • Actinomycin D

Chemicals Affecting TMEM52 Epigenetic Regulation:

  • 4,4'-sulfonyldiphenol (bisphenol S) increases methylation of TMEM52 promoter

Complex Interaction Effects:

  • 17beta-estradiol when co-treated with TGFB1 protein results in decreased TMEM52 mRNA expression

  • Actinomycin D when co-treated with nutlin 3 results in increased TMEM52 mRNA expression

These differential responses suggest TMEM52 may function in cellular stress response pathways and be subject to complex regulatory mechanisms. Researchers should consider these exposure effects when designing experiments, particularly when using chemical treatments that might indirectly affect TMEM52 expression.

What methodological approaches can be used to investigate TMEM52 function in relation to disease pathogenesis?

To investigate potential roles of TMEM52 in disease pathogenesis, researchers can employ these methodological approaches:

  • Expression Analysis in Disease vs. Normal Tissues:

    • Transcriptomic profiling to identify differential expression patterns

    • Immunohistochemistry on tissue microarrays to correlate expression with clinical outcomes

    • Consider using approaches similar to those that identified TMEM52B as a prognostic marker in NPC

  • Functional Studies:

    • Gene knockdown/knockout using siRNA or CRISPR-Cas9

    • Overexpression studies using tagged constructs

    • Domain mutation analysis to identify functional regions

  • Protein Interaction Studies:

    • Co-immunoprecipitation to identify binding partners

    • Proximity labeling approaches (BioID, APEX)

    • Investigate whether TMEM52, like TMEM52B, interacts with signaling proteins or enzymes

  • Subcellular Localization Analysis:

    • Immunofluorescence with subcellular markers

    • Cell fractionation followed by Western blotting

    • Consider that different localizations may indicate different functions, as seen with TMEM52B isoforms

  • Clinical Correlation Approaches:

    • Survival analysis using Kaplan-Meier methods

    • Cox proportional hazard regression models to determine if TMEM52 expression affects survival

    • Receiver operating curve analysis to assess TMEM52 as a potential biomarker

What are the current challenges and limitations in studying TMEM52 function?

Researchers face several methodological challenges when investigating TMEM52:

  • Limited Foundational Knowledge:

    • Minimal experimental evidence supporting molecular function, biological process, or cellular component annotations

    • Lack of well-characterized interaction partners or signaling pathways

  • Technical Challenges:

    • Membrane protein analysis typically requires specialized extraction and handling protocols

    • Potential difficulties in generating specific antibodies for detection

    • Limitations in structural analysis of transmembrane proteins

  • Expression Level Challenges:

    • If TMEM52 is expressed at low levels, specialized techniques for low abundance transcript/protein detection may be required

    • For qPCR analysis of low abundance targets, the more cycles amplified, the more variability comes into play

  • Functional Redundancy:

    • Potential functional overlap with other TMEM family proteins may complicate knockout/knockdown studies

    • Compensation mechanisms might mask phenotypes in model systems

  • Model System Limitations:

    • Cell-type specific functions may not be captured in standard cell line models

    • Appropriate animal models for in vivo functional studies may not be well established

Researchers should address these limitations through careful experimental design, incorporation of multiple complementary techniques, and thorough controls to ensure robust and reproducible findings.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.