Recombinant Human Transmembrane protein 53 (TMEM53)

Shipped with Ice Packs
In Stock

Description

General Information

Transmembrane protein 53 (TMEM53) is a protein in humans encoded by the TMEM53 gene . It is also found in other organisms, such as mice and rats . TMEM53 is expressed in tissues rich in ciliated cells and olfactory sensory neurons . It may negatively regulate bone morphogenetic protein (BMP) signaling in osteoblast lineage cells by blocking the translocation of phosphorylated SMAD proteins from the cytoplasm to the nucleus .

Structure and Function

TMEM53 contains 277 amino acids . TMEM53 has four RefSeq transcripts, named T.1 (NM_024587.4), T.2 (NM_001300746.1), T.3 (NM_001300747.2), and T.4 (NM_001300748.2), with T.1 showing the highest expression in multiple tissue and cell types . TMEM53 may function as a gatekeeper of BMP-SMAD signaling at the nuclear membrane .

Role in Disease

Deficiency of TMEM53 can cause sclerosing bone disorders by dysregulation of BMP-SMAD signaling . TMEM53 pathogenic variants can result in normal development until birth and late-onset short stature . Craniofacial dysmorphias, such as a tall forehead and hypertelorism, have been observed in individuals with TMEM53 pathogenic variants . Vision impairment due to optic nerve compression may also occur .

Research Findings

TMEM53 has been identified as a causal gene for a previously unknown type of sclerosing bone disorder (SBD) . Studies involving individuals with TMEM53 pathogenic variants revealed skeletal features such as platyspondyly (flattened vertebral bodies) and under-constriction of the diaphyses in tubular bones . TMEM53 deficiency enhances BMP signal-induced bone formation in calvaria cells . TMEM53 plays an inhibitory role in the activation process of the SMAD-dependent BMP signaling pathway . TMEM53 prevents the nuclear accumulation of SMAD1/5/9 without affecting their levels of expression and phosphorylation .

Expression

TMEM53 is highly expressed in the periosteal zone of tubular bones and the calvaria .

Genetic Information

Gene NameTMEM53
OrganismHumans
UniProt IDQ6P2H8
াকার Gene ID68777

Single Cell Type

TMEM53 is seen in single cell types .

CRISPR Screens

CRISPR screens have been done for TMEM53 (Homo sapiens) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
TMEM53; Transmembrane protein 53
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-277
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMEM53
Target Protein Sequence
MASAELDYTIEIPDQPCWSQKNSPSPGGKEAETRQPVVILLGWGGCKDKNLAKYSAIYHK RGCIVIRYTAPWHMVFFSESLGIPSLRVLAQKLLELLFDYEIEKEPLLFHVFSNGGVMLY RYVLELLQTRRFCRLRVVGTIFDSAPGDSNLVGALRALAAILERRAAMLRLLLLVAFALV VVLFHVLLAPITALFHTHFYDRLQDAGSRWPELYLYSRADEVVLARDIERMVEARLARRV LARSVDFVSSAHVSHLRDYPTYYTSLCVDFMRNCVRC
Uniprot No.

Target Background

Database Links

HGNC: 26186

KEGG: hsa:79639

STRING: 9606.ENSP00000361311

UniGene: Hs.22157

Protein Families
TMEM53 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

How is TMEM53 expression regulated in different tissues?

TMEM53 has four confirmed RefSeq transcripts (T.1: NM_024587.4, T.2: NM_001300746.1, T.3: NM_001300747.2, and T.4: NM_001300748.2), with T.1 showing the highest expression across multiple tissue and cell types . While specific transcriptional regulators of TMEM53 have not been fully characterized, experimental data indicate tissue-specific expression patterns.

For researchers investigating TMEM53 expression patterns, it is recommended to use transcript-specific primers for RT-PCR analysis, as different transcripts may predominate in different experimental contexts. When examining protein expression, researchers should consider the high conservation of TMEM53 across species (86.3% identity between human and mouse), which can inform cross-species experimental approaches .

What is the mechanism of TMEM53 inhibition of SADS-CoV replication?

TMEM53 has been identified as a novel cell-intrinsic restriction factor for Swine Acute Diarrhea Syndrome Coronavirus (SADS-CoV). Mechanistically, TMEM53 interacts with the viral non-structural protein 12 (NSP12) and disrupts the viral RNA-dependent RNA polymerase (RdRp) complex assembly by interrupting the NSP8-NSP12 interaction . This disruption suppresses viral RdRp activity and RNA synthesis, effectively inhibiting viral replication.

Unlike many other antiviral proteins, TMEM53's inhibitory effect on SADS-CoV infection operates independently of canonical type I interferon responses. Instead, TMEM53 directly interferes with the viral replication machinery .

For experimental verification of this mechanism, researchers should consider:

  • Co-immunoprecipitation assays to detect TMEM53-NSP12 interaction

  • Split luciferase complementation assays to visualize protein-protein interactions

  • In vitro RdRp activity assays with and without TMEM53

  • Viral RNA synthesis quantification using qRT-PCR in TMEM53-overexpressing and knockout models

How does the transmembrane domain of TMEM53 contribute to its antiviral activity?

The transmembrane domain of TMEM53 is critical for its antiviral function. Deletion experiments have demonstrated that removing the transmembrane domain abrogates both TMEM53-NSP12 interaction and TMEM53's antiviral activity . These findings suggest that proper membrane localization is essential for TMEM53 to exert its inhibitory effect on viral replication.

When designing truncation mutants to study TMEM53 function, researchers should preserve the structural integrity of the transmembrane domain or create precise deletions that specifically target this region to assess its contribution to antiviral activity.

What is the spectrum of antiviral activity for TMEM53?

TMEM53 exhibits broad antiviral activity against multiple HKU2-related coronaviruses, suggesting a specialized role in restricting this viral lineage . Current evidence indicates species-specificity in TMEM53's antiviral activity against HKU2-related CoVs.

To investigate TMEM53's antiviral spectrum, researchers should design experiments using:

  • Viral challenge assays with multiple viral species

  • TMEM53 overexpression and knockout systems

  • Chimeric TMEM53 proteins to identify domains responsible for virus specificity

  • Evolutionary analyses to identify signatures of positive selection that might indicate virus-host co-evolution

How does TMEM53 regulate BMP signaling in bone formation?

TMEM53 functions as a negative regulator of bone morphogenetic protein (BMP) signaling, which is critical for bone formation. Mechanistically, TMEM53 inhibits BMP signaling by blocking the cytoplasm-to-nucleus translocation of BMP2-activated Smad proteins (Smad1/5/9) .

In TMEM53-deficient cells, increased nuclear localization of phosphorylated Smad1/5/9 is observed without significant changes in total Smad protein levels or phosphorylation status. This indicates that TMEM53 primarily affects the subcellular trafficking of activated Smad proteins rather than their expression or initial phosphorylation .

For researchers studying this mechanism:

  • When examining Smad localization, both cytoplasmic and nuclear fractions should be analyzed separately

  • Total cell lysate analysis may not reveal differences in Smad activity between wild-type and TMEM53-deficient samples

  • Immunocytochemistry provides valuable spatial information about Smad localization that complements biochemical fractionation approaches

What phenotypes are observed in TMEM53-deficient models?

TMEM53 deficiency leads to a previously uncharacterized sclerosing bone disorder (SBD) in humans and similar phenotypes in mouse models. The key clinical and radiographic features include:

  • Normal prenatal and early postnatal development

  • Late-onset proportional or short-limbed short stature

  • Head deformities (macrocephaly, dolichocephaly, or prominent forehead)

  • Progressive vision diminishment due to optic nerve compression

  • Hyperostosis of the calvaria and skull base

  • Mild platyspondyly (flattened vertebral bodies)

  • Meta-diaphyseal under-modeling of long tubular bones

  • Normal laboratory findings for calcium, phosphorus, parathyroid hormone, and alkaline phosphatase

Tmem53 mutant mice recapitulate these phenotypes, showing normal development at birth followed by late-onset short stature, craniofacial dysmorphias, thickening of the calvaria, minor sclerosis of the skull base, platyspondyly, and under-constriction of the diaphyses .

Researchers working with TMEM53 knockout models should plan for longitudinal studies, as phenotypes emerge progressively rather than being present at birth.

How can researchers quantify the effects of TMEM53 on bone formation in vitro?

To quantify TMEM53's effects on bone formation in vitro, researchers can employ several methodological approaches:

  • Osteoblast differentiation assays: Primary calvaria cells from wild-type and Tmem53 mutant mice cultured with osteogenic induction media show enhanced bone formation capacity in mutant cells, particularly when stimulated with BMP2. This enhancement can be ablated by adding K02288, a selective inhibitor of BMP type I receptor kinases .

  • Marker gene expression analysis: Quantifying osteoblast markers (Bglap and Alpl) in response to BMP2 stimulus reveals higher expression in Tmem53-deficient cells compared to controls .

  • BMP reporter assays: Using reporter constructs to quantify SMAD-dependent BMP signaling activity demonstrates that BMP signaling is upregulated in TMEM53 knockout cells and downregulated when TMEM53 is overexpressed .

  • Subcellular fractionation and Western blotting: Analyzing cytoplasmic and nuclear fractions separately for phosphorylated Smad1/5/9 provides insights into TMEM53's effect on Smad protein trafficking .

These methods provide complementary data on how TMEM53 influences bone formation at the cellular and molecular levels.

What are the optimal expression systems for recombinant TMEM53 production?

Several expression systems have been successfully used for recombinant TMEM53 production, each with advantages for specific experimental applications:

Expression SystemTag OptionsPurityApplicationsNotes
Wheat germGSTNot specifiedELISA, WB, AP, Antibody ArrayFull-length human TMEM53 (AA 1-277)
HEK-293 CellsHis, Myc-DYKDDDDK>90%ELISA, WB, analytical SECSuitable for human (AA 1-277) and mouse (AA 1-276) TMEM53
Cell-free protein synthesis (CFPS)Strep>70-80%ELISA, WB, SDSOption for both human and mouse TMEM53

When selecting an expression system, researchers should consider:

  • Experimental requirements for protein purity

  • Need for post-translational modifications

  • Compatibility with downstream applications

  • Tag position and potential interference with protein function

  • Scale of production needed

For functional studies, it is crucial to verify that the recombinant protein retains proper folding and activity, particularly since the transmembrane domain is essential for TMEM53 function .

How can researchers effectively detect and quantify TMEM53 in experimental systems?

Detection and quantification of TMEM53 can be challenging due to its transmembrane nature. Several approaches have proven effective:

  • Western blotting: Using antibodies against either endogenous TMEM53 or epitope tags for recombinant versions. When analyzing subcellular fractions, proper membrane solubilization is critical.

  • Immunocytochemistry (ICC): Valuable for determining subcellular localization at the nuclear envelope. When performing ICC for TMEM53, appropriate fixation and permeabilization protocols are essential to preserve membrane structures.

  • qRT-PCR: For transcript-level analysis, specific primers for different TMEM53 transcripts should be used, as expression patterns vary across tissues .

  • Immunoprecipitation: Useful for studying protein-protein interactions, such as TMEM53-NSP12 binding .

For all detection methods, appropriate controls are essential, including TMEM53 knockout cells or tissues to confirm antibody specificity.

What considerations should be made when designing TMEM53 knockout or knockdown experiments?

When designing TMEM53 knockout or knockdown experiments, researchers should consider:

  • Targeting strategy: For CRISPR/Cas9-mediated gene editing, selecting targeting sites shared by all transcripts is crucial to guarantee disruption of all isoforms. In the mouse model described in the literature, a targeting site shared by all six RefSeq transcripts of Tmem53 was selected .

  • Validation methods: Confirm knockout or knockdown at both mRNA and protein levels, as residual expression of certain transcripts may confound results.

  • Phenotypic timeline: Since TMEM53 deficiency leads to late-onset phenotypes in both humans and mice, experimental timelines should be extended to capture progressive changes .

  • Control selection: Appropriate controls should include wild-type specimens of the same genetic background and, ideally, heterozygous specimens to assess gene dosage effects.

  • Conditional approaches: Given TMEM53's roles in multiple cellular processes, tissue-specific or inducible knockout systems may help distinguish primary from secondary effects.

For validating TMEM53 knockout effects on specific pathways, complementation experiments (restoring TMEM53 expression) should be performed to confirm phenotype reversibility, as demonstrated in BMP signaling studies .

How might TMEM53 function as a potential therapeutic target?

TMEM53's dual roles in viral restriction and bone development suggest two distinct therapeutic applications:

  • Antiviral therapeutics: Enhancing TMEM53 activity could potentially inhibit HKU2-related coronavirus infections. Understanding the molecular basis of TMEM53-NSP12 interaction could guide the development of small molecules that mimic this interaction and disrupt viral RdRp complex assembly .

  • Bone disorder treatments: For sclerosing bone disorders caused by TMEM53 deficiency, therapeutic approaches might target downstream BMP signaling. The selective BMP type I receptor kinase inhibitor K02288 has shown promise in ablating enhanced bone formation in Tmem53-deficient cells .

For researchers pursuing therapeutic development, structure-function analyses of TMEM53 will be critical to identify minimal functional domains that could serve as templates for drug design. Additionally, high-throughput screening approaches could identify small molecules that modulate TMEM53 activity or its downstream pathways.

What are the current challenges and future directions in TMEM53 research?

Current challenges and future directions in TMEM53 research include:

  • Structural characterization: Determining the three-dimensional structure of TMEM53, particularly in complex with its interaction partners (e.g., NSP12 or Smad proteins), would provide crucial insights for understanding function.

  • Tissue-specific roles: While TMEM53's functions in viral restriction and bone development have been characterized, its roles in other tissues remain largely unexplored. Tissue-specific knockout models could reveal additional functions.

  • Regulatory mechanisms: Understanding how TMEM53 itself is regulated at the transcriptional, translational, and post-translational levels remains an important knowledge gap.

  • Species-specific differences: While TMEM53 is highly conserved (86.3% identity between human and mouse), potential functional differences across species require further investigation, particularly regarding antiviral specificity .

  • Interaction networks: Comprehensive identification of TMEM53 interaction partners beyond those already identified would help contextualize its function within broader cellular pathways.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.