Recombinant Human Transmembrane protein 55A (TMEM55A)

Shipped with Ice Packs
In Stock

Description

General Information

TMEM55A, encoded by the PIP4P2 gene, is a transmembrane protein that functions as a lipid phosphatase . It was initially identified as an enzyme catalyzing the hydrolysis of phosphatidylinositol-4,5-bisphosphate (PIP2) to phosphatidylinositol-5-phosphate (PI5P) . TMEM55A is expressed throughout the body, including in the pancreas .

Function and Mechanism

TMEM55A regulates alpha-cell exocytosis and glucagon secretion by manipulating intracellular PI5P levels and the F-actin network . Specifically, TMEM55A increases intracellular PI5P levels to promote F-actin depolymerization via inhibition of the small G-protein RhoA . Oxidative stress acts upstream of the TMEM55A/PI5P/F-actin axis, resulting in increased glucagon exocytosis and glucagon hypersecretion .

Role in Cellular Processes

TMEM55A plays a role in various cellular processes:

  • Alpha-Cell Exocytosis: TMEM55A positively regulates α-cell exocytosis by increasing intracellular PI5P levels, which promotes F-actin depolymerization .

  • Glucagon Secretion: TMEM55A regulates glucagon secretion in pancreatic islet α-cells .

  • Phagocytosis: TMEM55a negatively regulates the phagocytosis of large particles by reducing phagosomal PtdIns(4,5)P2 accumulation in macrophages .

  • Cholesterol Metabolism: TMEM55B, a protein similar to TMEM55A, regulates cellular cholesterol metabolism .

Association with Diseases

  • Diabetes: TMEM55A is associated with the dysfunction of glucagon-producing pancreatic islet α-cells, which is linked to diabetes .

  • Osteosarcoma: Another member of the TMEM family, TMEM45B, is upregulated in human osteosarcoma cell lines and plays a role in regulating the proliferation, migration, and invasion of osteosarcoma cells .

  • Cancer: TMEM45B has been found to be overexpressed in lung cancer, and silencing TMEM45B inhibits lung cancer cell proliferation in vitro and in vivo .

TMEM55A and TMEM55B Interaction with Tex2

TMEM55B interacts with Tex2, which is required for lysosomal functions at TMEM55-dependent ER . Overexpression of Halo-TMEM55B recruits GFP-Tex2 to perinuclear regions, suggesting a specific interaction between Tex2 and TMEM55B .

Data Tables

GeneDescriptionFunctionAssociated Diseases
TMEM55ATransmembrane protein 55A, lipid phosphataseRegulates alpha-cell exocytosis and glucagon secretion by manipulating intracellular PI5P levels and the F-actin networkDiabetes
TMEM55BTransmembrane protein 55B, phosphataseRegulates cellular cholesterol metabolism, modulates LDLR turnover, activity, or localizationN/A
TMEM45BTransmembrane protein 45BRegulates the proliferation, migration, and invasion of osteosarcoma cells, may serve as an oncogene in the development and progression of osteosarcomaOsteosarcoma, Lung Cancer

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PIP4P2; TMEM55A; Type 2 phosphatidylinositol 4,5-bisphosphate 4-phosphatase; Type 2 PtdIns-4,5-P2 4-Ptase; PtdIns-4,5-P2 4-Ptase II; Transmembrane protein 55A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-257
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MAADGVDERSPLLSASHSGNVTPTAPPYLQESSPRAELPPPYTAIASPDASGIPVINCRV CQSLINLDGKLHQHVVKCTVCNEATPIKNPPTGKKYVRCPCNCLLICKDTSRRIGCPRPN CRRIINLGPVMLISEEQPAQPALPIQPEGTRVVCGHCGNTFLWMELRFNTLAKCPHCKKI SSVGSALPRRRCCAYITIGMICIFIGVGLTVGTPDFARRFRATYVSWAIAYLLGLICLIR ACYWGAIRVSYPEHSFA
Uniprot No.

Target Background

Function

This recombinant human transmembrane protein 55A (TMEM55A) catalyzes the hydrolysis of phosphatidylinositol-4,5-bisphosphate (PtdIns-4,5-P2) to phosphatidylinositol-4-phosphate (PtdIns-4-P). It does not hydrolyze phosphatidylinositol 3,4,5-trisphosphate, phosphatidylinositol 3,4-bisphosphate, inositol 3,5-bisphosphate, inositol 3,4-bisphosphate, phosphatidylinositol 5-monophosphate, phosphatidylinositol 4-monophosphate, or phosphatidylinositol 3-monophosphate. Furthermore, TMEM55A negatively regulates the phagocytosis of large particles by reducing phagosomal phosphatidylinositol 4,5-bisphosphate accumulation during cup formation.

Gene References Into Functions
  1. Identification and characterization of two previously undescribed human enzymes, PtdIns-4,5-P(2) 4-phosphatase type I and type II. PMID: 16365287
Database Links

HGNC: 25452

OMIM: 609864

KEGG: hsa:55529

STRING: 9606.ENSP00000285419

UniGene: Hs.202517

Subcellular Location
Late endosome membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein. Cytoplasmic vesicle, phagosome membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Ubiquitous.

Q&A

What is TMEM55A and what is its primary function?

TMEM55A (Transmembrane Protein 55A), encoded by the PIP4P2 gene, is a phosphoinositide 4-phosphatase that catalyzes the hydrolysis of phosphatidylinositol-4,5-bisphosphate (PIP2) to phosphatidylinositol-5-phosphate (PI5P). It contains a CX5R motif in its phosphatase domain and two putative transmembrane domains at its C-terminus . The enzyme primarily functions by dephosphorylating the D4 position of PI(4,5)P2, showing specificity for this phosphoinositide substrate rather than other phosphoinositides . While its in vitro catalytic activity has been well-characterized, demonstrating the in vivo conversion of polyphosphoinositide into PtdIns(5)P remains an active area of research .

How does TMEM55A differ from TMEM55B?

TMEM55A and TMEM55B are closely related isozymes that share 51% amino acid sequence identity . Both contain a CX5R motif in their phosphatase domains and two putative transmembrane domains at their C-termini . Both enzymes function as phosphoinositide 4-phosphatases that dephosphorylate the D4 position of PI(4,5)P2, primarily on late endosome/lysosome membranes . While they have similar catalytic functions, they may have tissue-specific expression patterns and unique physiological roles. For instance, TMEM55B has been specifically implicated in autophagy flux, lysosomal repair, and TFE3 signaling during oxidative stress , while TMEM55A has been shown to regulate α-cell exocytosis and glucagon secretion in pancreatic cells .

Where is TMEM55A predominantly expressed and localized?

TMEM55A is expressed throughout the body, including in the pancreas . At the subcellular level, TMEM55A is predominantly localized to late endosome/lysosome membranes, where it performs its phosphatase function on PI(4,5)P2 . In macrophages, fluorescently tagged TMEM55A has been observed to localize to phagosomes, suggesting a role in phagosomal membrane dynamics and function . In pancreatic α-cells, TMEM55A plays a critical role in regulating exocytosis and glucagon secretion, particularly under low glucose conditions .

What are the recommended methods for producing recombinant TMEM55A?

For producing recombinant TMEM55A, researchers should consider expression systems that maintain post-translational modifications and proper protein folding. While not specifically detailed for TMEM55A in the provided search results, similar membrane proteins have been successfully expressed using yeast systems like Pichia pastoris. Based on approaches used for other membrane proteins, a viable methodology would include:

  • Gene synthesis with optimized codons for the expression system

  • Subcloning into an appropriate expression vector (e.g., pPICZBα)

  • Addition of a His-tag (6-10 histidine residues) for purification

  • Transformation of yeast cells using electroporation

  • Selection on plates with increasing antibiotic concentrations

  • Screening colonies for expression using immunoblot analysis

  • Scale-up of high-yielding clones

  • Induction of expression (e.g., with methanol for P. pastoris)

  • Optimization of expression conditions (temperature, induction time)

What purification strategies are most effective for maintaining TMEM55A functionality?

For membrane proteins like TMEM55A, maintaining functionality during purification is critical. Based on methodologies used for similar membrane proteins, effective purification strategies would include:

  • Membrane preparation: Harvesting cells and isolating total cell membranes through differential centrifugation

  • Solubilization options:

    • Detergent-based: Using mild detergents like DDM (Dodecyl β-D-maltoside) at 2% concentration, potentially with 0.2% CHS (Cholesterol hemisuccinate)

    • Polymer-based: Using 2.5% DIBMA (Diisobutylene-maleic acid) or 2.5% SMA (Styrene-maleic acid) copolymers for detergent-free extraction

  • Affinity purification: Using immobilized metal affinity chromatography (IMAC) with Ni-NTA resin to capture His-tagged protein

  • Size-exclusion chromatography: Further purifying the protein and ensuring homogeneity

  • Functional verification: Using binding assays or enzymatic activity measurements to confirm protein functionality

The detergent-free DIBMA approach may be particularly beneficial as it avoids the instability that can result from detergent solubilization while maintaining the native lipid environment of the protein .

How can the enzymatic activity of TMEM55A be accurately measured?

To measure the enzymatic activity of TMEM55A, researchers should consider assays that quantify its phosphatase activity on PI(4,5)P2 substrate:

  • In vitro phosphatase assay:

    • Incubation of purified TMEM55A with PI(4,5)P2 substrate

    • Quantification of PI5P product formation using thin-layer chromatography (TLC) or high-performance liquid chromatography (HPLC)

    • Measurement of released phosphate using colorimetric assays (e.g., malachite green)

  • Cellular PI5P level measurement:

    • Extraction of cellular lipids

    • Separation and quantification of PI5P using mass spectrometry

    • Comparison between control and TMEM55A-manipulated cells

  • Functional rescue experiments:

    • Knockdown of TMEM55A in target cells (e.g., α-cells)

    • Assessment of cellular functions (e.g., exocytosis)

    • Rescue by direct introduction of PI5P to verify enzyme function

These approaches allow for both direct measurement of enzymatic activity and validation of functional consequences in cellular systems.

How does TMEM55A affect phagocytosis in macrophages?

TMEM55A plays a regulatory role in macrophage phagocytosis, particularly for large particles. Studies in mouse macrophages (Raw264.7) demonstrate:

  • TMEM55A-deficient macrophages show increased engulfment of large particles without affecting the phagocytosis of Escherichia coli, suggesting a size-selective regulatory mechanism.

  • TMEM55A primarily localizes to the phagosome, as confirmed by fluorescence microscopy of transfected cells.

  • Mechanistically, TMEM55A appears to downregulate phagocytosis by depleting PtdIns(4,5)P2 levels:

    • TMEM55A-deficient cells show increased accumulation of PtdIns(4,5)P2, PtdIns(3,4,5)P3, and F-actin on the phagocytic cup

    • Transfection with bacterial phosphatase IpgD (with similar substrate specificity to TMEM55A) inhibits phagocytosis in a phosphatase-dependent manner

    • Conversely, transfection with PIP4K2a, which catalyzes PtdIns(4,5)P2 production from PtdIns(5)P, increases phagocytosis

  • Phagosomal PtdIns(5)P was decreased in TMEM55A knockdown cells, but exogenous addition of PtdIns(5)P did not affect the augmented phagocytosis in these cells, suggesting that reduced PtdIns(4,5)P2 rather than increased PtdIns(5)P is the primary mechanism for TMEM55A's effect on phagocytosis .

What role does TMEM55A play in glucagon secretion from pancreatic α-cells?

TMEM55A is a critical regulator of glucagon secretion from pancreatic α-cells through a PI5P-dependent mechanism:

  • Gene expression analysis shows that PIP4P2 (encoding TMEM55A) expression positively correlates with α-cell glucagon exocytosis, while negatively correlating with β-cell insulin exocytosis.

  • Functional studies demonstrate:

    • TMEM55A knockdown in both human and mouse α-cells reduces exocytosis at low glucose conditions

    • This reduced exocytosis can be rescued by direct reintroduction of PI5P, confirming the mechanism is dependent on TMEM55A's phosphatase activity

  • The mechanism does not involve effects on Ca2+ channel activity, but rather:

    • TMEM55A increases intracellular PI5P levels

    • This promotes F-actin depolymerization via inhibition of the small G-protein RhoA

    • The resulting remodeling of cortical F-actin facilitates exocytosis

  • Importantly, this pathway is responsive to oxidative stress, which acts upstream of the TMEM55A/PI5P/F-actin axis, resulting in increased glucagon exocytosis and potential glucagon hypersecretion in diabetic conditions .

How is TMEM55A involved in lysosomal function?

While the search results focus more on TMEM55B's role in lysosomes, they provide insights into how TMEM55A may function in this context:

  • Like TMEM55B, TMEM55A is a phosphoinositide 4-phosphatase that dephosphorylates PI(4,5)P2 mainly on late endosome/lysosome membranes .

  • TMEM55A can recruit Tex2, a potential lipid transporter on the tubular endoplasmic reticulum, to late endosome/lysosome membranes:

    • Live-cell confocal microscopy shows that Halo-TMEM55A strongly recruits GFP-Tex2 to TMEM55A-positive late endosome/lysosome membranes

    • This recruitment is similar in extent to that observed with TMEM55B

  • The interaction between TMEM55A and Tex2 likely involves specific protein domains:

    • The N-terminal region of Tex2 (residues 1-517) is critical for this interaction

    • Within this region, residues 1-276 are essential but not sufficient for recruitment

    • The SMP domain of Tex2 is not required for interaction with TMEM55A

This interaction is likely important for lipid transport between the ER and lysosomes, potentially regulating lysosomal membrane composition and function.

How does oxidative stress modulate TMEM55A activity?

Oxidative stress has been identified as a modulator of TMEM55A activity, particularly in the context of pancreatic α-cells:

  • Research evidence indicates that oxidative stress acts upstream of the TMEM55A/PI5P/F-actin axis in α-cells, leading to:

    • Increased TMEM55A phosphatase activity

    • Elevated PI5P levels

    • F-actin depolymerization

    • Enhanced glucagon exocytosis

  • The mechanism appears to involve:

    • TMEM55A-mediated dephosphorylation of PI(4,5)P2 to PI5P

    • PI5P-dependent inhibition of the small G-protein RhoA

    • Subsequent remodeling of cortical F-actin to facilitate exocytosis

  • This pathway provides a molecular link between oxidative stress, which is often elevated in diabetic conditions, and the observed dysregulation of glucagon secretion in diabetes .

To experimentally investigate this relationship, researchers should consider:

  • Using oxidative stress inducers (e.g., H2O2, arsenite) to trigger the pathway

  • Quantifying changes in TMEM55A localization and activity under stress conditions

  • Measuring PI5P and PI(4,5)P2 levels, RhoA activity, and F-actin dynamics

  • Assessing functional outcomes such as exocytosis or secretion rates

What is the relationship between TMEM55A and membrane contact sites?

The interaction between TMEM55A and Tex2 suggests a role for TMEM55A in regulating membrane contact sites between the endoplasmic reticulum (ER) and late endosomes/lysosomes (LE/lys):

  • Tex2 is a potential lipid transporter that resides on tubular ER and can be recruited to LE/lys by TMEM55A .

  • Live-cell confocal microscopy reveals that TMEM55A recruitment of Tex2 results in:

    • Wrapping of Tex2-labeled ER tubules around LE/lys

    • Formation of potential membrane contact sites between these organelles

  • This interaction could facilitate:

    • Lipid transfer between ER and LE/lys membranes

    • Regulation of LE/lys membrane composition

    • Control of lysosomal function and dynamics

Experimental approaches to study this relationship should include:

  • Super-resolution microscopy to visualize membrane contact sites

  • Proximity labeling techniques to identify additional proteins at these contacts

  • Lipid transfer assays to assess functional consequences

  • Domain mapping studies to further characterize the interaction interfaces

What crosstalk exists between TMEM55A and other phosphoinositide-metabolizing enzymes?

Understanding the crosstalk between TMEM55A and other phosphoinositide-metabolizing enzymes is crucial for comprehending its role in cellular phosphoinositide homeostasis:

  • Research indicates a functional relationship between TMEM55A and PIP4K2a:

    • TMEM55A dephosphorylates PI(4,5)P2 to PI5P

    • PIP4K2a catalyzes the reverse reaction, producing PI(4,5)P2 from PI5P

    • Transfection with PIP4K2a in macrophages increases phagocytosis, opposing TMEM55A's effect

  • This suggests a dynamic equilibrium between these enzymes that regulates:

    • The balance between PI(4,5)P2 and PI5P levels

    • Downstream cellular processes dependent on these phosphoinositides

    • Organelle-specific phosphoinositide profiles

To investigate this crosstalk, researchers should consider:

  • Co-expression and knockdown studies of TMEM55A with other phosphoinositide-metabolizing enzymes

  • Phosphoinositide profiling in different cellular compartments

  • Temporal analysis of enzyme activities following stimulation

  • Mathematical modeling of phosphoinositide interconversion pathways

What are common challenges in TMEM55A activity assays and how can they be addressed?

Based on the nature of phosphoinositide phosphatases like TMEM55A, several technical challenges may arise when assessing their activity:

  • Substrate accessibility issues:

    • Challenge: PI(4,5)P2 is often in membrane environments, potentially limiting accessibility

    • Solution: Use appropriate detergents or lipid vesicle systems that maintain enzyme-substrate interaction while preserving enzyme activity

  • Product detection sensitivity:

    • Challenge: Detecting small changes in PI5P levels in complex lipid mixtures

    • Solution: Employ sensitive analytical techniques such as HPLC-MS/MS or develop specific PI5P biosensors

  • Distinguishing from other phosphatases:

    • Challenge: Other phosphatases may have overlapping activities

    • Solution: Use specific inhibitors, conduct assays with purified enzymes, or use TMEM55A knockout/knockdown controls

  • Verifying in vivo activity:

    • Challenge: In vitro TMEM55A activity has been demonstrated, but in vivo conversion of PI(4,5)P2 to PI5P is challenging to confirm

    • Solution: Combine genetic manipulation of TMEM55A with quantitative lipidomics and functional rescue experiments

How can researchers effectively manipulate TMEM55A expression in different cell types?

For effective manipulation of TMEM55A expression across various experimental systems:

  • Knockdown approaches:

    • siRNA transfection: Effective for transient knockdown in easily transfectable cells

    • shRNA expression: For stable knockdown in long-term experiments

    • Antisense oligonucleotides: Alternative approach for difficult-to-transfect cells

  • Knockout strategies:

    • CRISPR-Cas9: Design guide RNAs targeting PIP4P2 gene exons

    • Animal models: Knockout of tmem55 genes in models such as zebrafish for in vivo studies

  • Overexpression methods:

    • Transient transfection: Using expression vectors with appropriate promoters

    • Stable cell lines: Creating cells with inducible expression systems

    • Viral delivery: For difficult-to-transfect cells or in vivo applications

  • System-specific considerations:

    • For primary cells like pancreatic α-cells, optimize transfection conditions or use viral vectors

    • For macrophages, consider electroporation or specialized transfection reagents

What are the best approaches for studying TMEM55A protein-protein interactions?

To effectively investigate TMEM55A's interactions with other proteins:

  • Co-immunoprecipitation (co-IP) techniques:

    • GFP-Trap assays have been successfully used to demonstrate TMEM55A-Tex2 interactions

    • Use appropriate tags (e.g., Halo-tag, GFP) that don't interfere with protein function

    • Include proper controls to validate specific interactions

  • Proximity labeling methods:

    • BioID or TurboID: Fuse biotin ligase to TMEM55A to identify nearby proteins

    • APEX2: Alternative enzyme-based proximity labeling approach

    • These techniques are particularly valuable for identifying transient or weak interactions

  • Microscopy-based approaches:

    • Live-cell confocal microscopy has been effective in visualizing TMEM55A recruitment of Tex2

    • Förster resonance energy transfer (FRET) to detect direct protein interactions

    • Super-resolution microscopy for detailed co-localization studies

  • Domain mapping strategies:

    • Create deletion mutants to identify interaction domains, as done for the Tex2-TMEM55A interaction

    • Use peptide arrays or yeast two-hybrid screening for fine mapping of interaction interfaces

    • Validate functional significance of identified interactions through mutation studies

By employing these approaches, researchers can build a comprehensive understanding of TMEM55A's interaction network and its functional implications in various cellular processes.

How might TMEM55A function differ across tissue and cell types?

While current research has focused on TMEM55A's role in macrophages and pancreatic α-cells, its expression throughout the body suggests diverse functions:

  • Tissue-specific expression analysis:

    • Comprehensive profiling of TMEM55A expression across tissues

    • Correlation with PI5P levels and related cellular processes

    • Comparison with TMEM55B expression patterns to identify unique vs. overlapping functions

  • Cell type-specific studies:

    • Investigation of TMEM55A in neuronal cells, given the importance of phosphoinositide signaling in neurotransmission

    • Exploration of its role in immune cells beyond macrophages

    • Assessment of function in metabolic tissues in relation to diabetes and metabolic disorders

  • Clinical correlations:

    • Analysis of TMEM55A expression in patient samples from various diseases

    • Investigation of genetic variants affecting TMEM55A function and their association with disease risk

What is the significance of TMEM55A in pathological conditions?

Emerging evidence suggests TMEM55A may play important roles in various pathological conditions:

  • Diabetes and metabolic disorders:

    • TMEM55A's role in regulating glucagon secretion links it directly to diabetes pathophysiology

    • The TMEM55A/PI5P/F-actin axis responds to oxidative stress, which is elevated in diabetic conditions

    • This pathway may contribute to the dysregulated glucagon secretion observed in both T1D and T2D

  • Oxidative stress-related conditions:

    • TMEM55A function is modulated by oxidative stress

    • This connection may extend to other oxidative stress-related pathologies, including neurodegenerative diseases and aging

  • Lysosomal storage diseases:

    • Given TMEM55A's localization to lysosomes and involvement in lipid metabolism, it may play a role in lysosomal storage disorders

    • Investigation in disease models could reveal therapeutic opportunities

Future research should explore these connections through disease models, patient-derived samples, and genetic association studies.

How can targeted modulation of TMEM55A be achieved for research applications?

Developing tools for precise modulation of TMEM55A activity would advance research in this field:

  • Small molecule modulators:

    • Development of specific TMEM55A inhibitors based on its phosphatase domain structure

    • Screening for activators that could enhance TMEM55A function

    • Design of compounds that selectively target TMEM55A over related phosphatases like TMEM55B

  • Engineered protein tools:

    • Creation of optogenetic or chemogenetic TMEM55A variants for temporally controlled activation

    • Development of degrader technologies (e.g., PROTACs) for rapid protein depletion

    • Design of split-protein systems for induced dimerization and activation

  • Target delivery strategies:

    • Cell-type specific expression systems for tissue-selective modulation

    • Organelle-targeted variants for compartment-specific studies

    • Nanoparticle delivery of modulators or genetic tools

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.