Recombinant Human Transmembrane protein 64 (TMEM64)

Shipped with Ice Packs
In Stock

Description

Subcellular Localization

TMEM64 is predicted to localize to the integral component of cellular membranes, particularly in the endoplasmic reticulum . This localization is consistent with its functional role in calcium homeostasis, as the endoplasmic reticulum serves as a major intracellular calcium store. The membrane-spanning regions of TMEM64 facilitate its interaction with other proteins involved in calcium regulation.

Expression Systems

Recombinant human TMEM64 can be produced using various expression systems, each offering distinct advantages:

  1. Bacterial expression in Escherichia coli: Provides high yield and cost-effective production

  2. Plant-based cell-free protein synthesis using Tobacco (Nicotiana tabacum): Offers alternative expression with potential for specific post-translational modifications

These expression systems enable the production of functional recombinant TMEM64 for research applications.

SERCA2 Interaction

A fundamental aspect of TMEM64 function is its interaction with sarcoplasmic endoplasmic reticulum Ca²⁺ ATPase 2 (SERCA2) . This interaction has been demonstrated to modulate SERCA2 activity, thereby influencing intracellular calcium dynamics. SERCA2 is responsible for pumping calcium from the cytosol into the endoplasmic reticulum, and TMEM64's regulatory effect on this process positions it as a key mediator of calcium homeostasis.

Calcium Oscillation Regulation

Research has established that TMEM64 plays a critical role in regulating receptor activator of nuclear factor kappa-B ligand (RANKL)-induced calcium oscillations . Studies using TMEM64-deficient bone marrow macrophages (BMMs) have demonstrated significantly diminished calcium oscillations in response to RANKL stimulation. These oscillations are essential for activating downstream signaling cascades, particularly the calcium/calmodulin-dependent protein kinase IV (CaMKIV) pathway .

The calcium oscillations regulated by TMEM64 also influence the production of mitochondrial reactive oxygen species (ROS), which serve as secondary messengers in various cellular signaling pathways . This interconnection between calcium signaling and ROS production highlights the multifaceted role of TMEM64 in cellular physiology.

Osteoclast Differentiation

One of the most extensively studied functions of TMEM64 is its role in osteoclast differentiation. TMEM64 acts as a positive modulator of osteoclastogenesis through its effects on calcium signaling . The mechanism involves several steps:

  1. TMEM64 interacts with SERCA2 in osteoclast precursors

  2. This interaction modulates calcium oscillations induced by RANKL

  3. Calcium oscillations activate CaMKIV, leading to CREB phosphorylation

  4. Activated CREB upregulates key transcription factors including c-fos and NFATc1

  5. These transcription factors drive the expression of genes essential for osteoclast differentiation and function

In TMEM64-deficient mice, this signaling cascade is disrupted, resulting in impaired osteoclast formation and increased bone mass .

Bone Mass Regulation

The role of TMEM64 in bone metabolism extends beyond osteoclast differentiation. Studies have demonstrated that TMEM64-deficient mice exhibit:

  1. Increased bone mass

  2. Reduced serum TRACP-5b (an early marker of osteoclast formation)

  3. Increased osteoblast surface area

  4. Enhanced bone formation rates

  5. Elevated serum osteocalcin levels (indicative of osteoblast activity)

These findings suggest that TMEM64 influences bone homeostasis through dual effects on bone resorption (via osteoclasts) and bone formation (via osteoblasts). The increased bone mass in TMEM64-deficient mice indicates that TMEM64 may serve as a potential therapeutic target for conditions characterized by excessive bone loss.

Functional Studies

Recombinant TMEM64 protein serves as a valuable tool for investigating calcium signaling pathways and bone metabolism. Specific applications include:

  1. In vitro studies of protein-protein interactions, particularly with SERCA2

  2. Examination of calcium oscillation mechanisms in various cell types

  3. Investigation of osteoclast differentiation pathways

  4. Structure-function analyses of TMEM64 domains

Analytical Applications

The availability of high-purity recombinant TMEM64 enables various analytical applications:

  1. Western Blotting: For detection and quantification of TMEM64 in biological samples

  2. ELISA: For sensitive measurement of TMEM64 levels

  3. SDS-PAGE: For analysis of protein purity and molecular weight

  4. Protein interaction assays: For identifying binding partners and regulatory mechanisms

Therapeutic Potential

The demonstrated role of TMEM64 in bone metabolism suggests potential therapeutic applications. By targeting TMEM64 or its interactions with other proteins, it may be possible to modulate bone remodeling processes in conditions such as osteoporosis, where excessive bone resorption leads to decreased bone density and increased fracture risk .

Comparative Analysis of TMEM64 Across Species

TMEM64 is conserved across various species, indicating its evolutionary importance. Orthologs have been identified in numerous organisms including mouse, zebrafish, and various mammalian species . This conservation facilitates comparative studies that can provide insights into the fundamental roles of TMEM64 in cellular physiology.

Studies in mouse models have been particularly informative, demonstrating the phenotypic consequences of TMEM64 deficiency on bone metabolism . These models have confirmed the role of TMEM64 in calcium signaling and osteoclast differentiation, validating findings from in vitro studies with recombinant human TMEM64.

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TMEM64; Transmembrane protein 64
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-380
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMEM64
Target Protein Sequence
MRSPGGILLQALPRLLQHAALPGLAELPARWALPRGAGGDGPADRLPRGGGASAAAAAAA ASGALLGAYLERHGPPEASELPEPGGALAGGPGSGGGGVVVGVAEVRNWRCCCLGSTCWC RSLVLVCVLAALCFASLALVRRYLHHLLLWVESLDSLLGVLLFVVGFIVVSFPCGWGYIV LNVAAGYLYGFVLGMGLMMVGVLIGTFIAHVVCKRLLTAWVAARIQSSEKLSAVIRVVEG GSGLKVVALARLTPIPFGLQNAVFSITDLSLPNYLMASSVGLLPTQLLNSYLGTTLRTME DVIAEQSVSGYFVFCLQIIISIGLMFYVVHRAQVELNAAIVACEMELKSSLVKGNQPNTS GSSFYNKRTLTFSGGGINVV
Uniprot No.

Target Background

Function
Recombinant Human Transmembrane protein 64 (TMEM64) positively regulates TNFSF11-induced osteoclast differentiation. It acts as a regulator of TNFSF11-mediated Ca²⁺ signaling pathways through interaction with SERCA2. This interaction is crucial for TNFSF11-induced CREB1 activation and mitochondrial ROS generation, essential for proper osteoclastogenesis. The association of TMEM64 and SERCA2 in the endoplasmic reticulum (ER) leads to cytosolic Ca²⁺ spiking, activating NFATC1 and producing mitochondrial ROS, thereby triggering Ca²⁺ signaling cascades that promote osteoclast differentiation and activation. Conversely, TMEM64 negatively regulates osteoblast differentiation and positively regulates adipocyte differentiation by modulating the canonical Wnt signaling pathway. It mediates the lineage commitment switch from adipogenesis to osteogenesis in mesenchymal stem cells by negatively regulating CTNNB1 expression, activity, and nuclear localization.
Database Links

HGNC: 25441

KEGG: hsa:169200

STRING: 9606.ENSP00000414786

UniGene: Hs.567759

Protein Families
TVP38/TMEM64 family
Subcellular Location
Membrane; Multi-pass membrane protein. Endoplasmic reticulum.

Q&A

What is TMEM64 and what is its primary function in cellular physiology?

TMEM64 is a transmembrane protein that functions as a critical regulator of calcium signaling pathways. Research has identified TMEM64 as a positive modulator of osteoclast differentiation through its interaction with sarcoplasmic endoplasmic reticulum Ca²⁺ ATPase 2 (SERCA2). This interaction plays a key role in mediating RANKL-induced calcium (Ca²⁺) oscillation, which is essential for proper osteoclast formation and function . The protein is expressed in osteoclast lineage cells, and its expression increases during RANKL-induced osteoclast differentiation, suggesting its regulatory importance in bone metabolism . TMEM64's primary function appears to be modulating intracellular calcium homeostasis through its effects on SERCA2 activity, thereby influencing downstream calcium-dependent signaling pathways that are critical for cellular differentiation processes.

How do knockout models demonstrate TMEM64's physiological significance?

TMEM64 knockout mice exhibit significant phenotypic changes in bone metabolism, providing strong evidence for the protein's physiological importance. Studies have shown that TMEM64-deficient mice develop increased bone mass primarily due to impaired osteoclast formation . Micro-computed tomography (μCT) analysis of these knockout mice revealed distinct alterations in bone microstructure compared to wild-type controls. Additionally, serum markers of osteoclast activity, such as TRACP-5b, were significantly reduced in TMEM64-deficient mice, further supporting an intrinsic defect in osteoclast differentiation .

These knockout models have revealed that TMEM64 deficiency not only affects osteoclast function but also influences osteoblast activity, indicating a potential role in the coupling between bone resorption and formation. Interestingly, TMEM64 knockout mice showed increases in osteoblast surface area and bone formation rates, suggesting compensatory mechanisms or direct effects on osteoblast lineage cells . These findings collectively underscore TMEM64's significance in maintaining bone homeostasis through its effects on both osteoclasts and osteoblasts.

What are the recommended techniques for isolating and culturing primary cells for TMEM64 research?

For studying TMEM64 in primary cells, the following methodological approach is recommended:

  • Bone Marrow Macrophage (BMM) Isolation: Harvest bone marrow from femurs and tibias of mice (typically 6-10 weeks old). Flush the marrow cavity with α-MEM containing antibiotics. After removing red blood cells using lysis buffer, culture cells in α-MEM supplemented with 10% FBS and M-CSF (20-30 ng/ml) for 3 days to generate BMMs .

  • Osteoclast Differentiation Protocol: Culture purified BMMs with M-CSF (30 ng/ml) and RANKL (100 ng/ml) for 3-5 days to induce osteoclast differentiation. For TMEM64 research specifically, monitor calcium signaling during this process using calcium indicator dyes .

  • Validation of Cell Phenotypes: Confirm osteoclast formation through TRAP (tartrate-resistant acid phosphatase) staining, and quantify multinucleated TRAP-positive cells. For functional assays, assess bone resorption capacity using dentine slices .

  • Expression Analysis: Monitor TMEM64 expression during differentiation using quantitative RT-PCR, Western blotting, or immunofluorescence techniques. Northern blot analysis can also be employed to confirm knockout or knockdown efficiency .

When isolating cells from TMEM64 knockout models, it's essential to confirm genotypes through PCR analysis of genomic DNA and validate the absence of protein expression through Western blotting or immunostaining methods.

How can researchers effectively measure TMEM64-mediated calcium signaling in osteoclast precursors?

Measuring TMEM64-mediated calcium signaling in osteoclast precursors requires specialized techniques to capture the dynamic nature of calcium oscillations. The following methodological approach is recommended:

  • Calcium Imaging Protocol: Load BMMs or pre-osteoclasts with a calcium indicator dye such as Fura-2AM (5 μM) for 30 minutes at 37°C. After washing with Hanks' balanced salt solution, monitor intracellular calcium ([Ca²⁺]i) oscillations using ratiometric fluorescence imaging with excitation at 340 and 380 nm and emission at 510 nm .

  • Real-time Monitoring: To properly assess RANKL-induced calcium oscillations, continuous monitoring should be performed for at least 10-15 minutes after stimulation, with images captured every 3-5 seconds. The oscillation frequency, amplitude, and pattern should be quantified .

  • Analysis Parameters: Key parameters to measure include: (a) percentage of cells exhibiting oscillations, (b) oscillation frequency (peaks/minute), (c) oscillation amplitude (peak-to-baseline ratio), and (d) integrated calcium response over time .

  • Comparative Analysis: Always conduct parallel experiments with wild-type and TMEM64-deficient cells under identical conditions. This approach can reveal specific defects in calcium signaling attributable to TMEM64, such as the impaired RANKL-induced [Ca²⁺]i oscillation observed in TMEM64-deficient BMMs .

  • Manipulation Experiments: To further characterize TMEM64's role, perform rescue experiments by reintroducing TMEM64 (e.g., using MSCV-TMEM64 retroviral vectors) into knockout cells and measuring the restoration of calcium oscillations .

This comprehensive approach allows researchers to precisely quantify how TMEM64 influences calcium dynamics during osteoclast differentiation and correlate these findings with downstream signaling events.

What techniques are optimal for investigating TMEM64-SERCA2 interactions?

Investigating the interaction between TMEM64 and SERCA2 requires multiple complementary approaches to establish both physical association and functional consequences:

  • Co-immunoprecipitation (Co-IP): This is the primary method for demonstrating physical interaction. Protocols should include:

    • Lysing cells in a buffer containing 1% NP-40 or similar mild detergent

    • Immunoprecipitating with anti-TMEM64 antibodies followed by immunoblotting for SERCA2, or vice versa

    • Including appropriate controls (isotype antibodies, knockout cell lysates)

  • Proximity Ligation Assay (PLA): This technique can visualize protein-protein interactions in situ with high specificity and sensitivity, allowing detection of endogenous TMEM64-SERCA2 complexes within their cellular context.

  • SERCA2 Activity Assays: Measuring SERCA2 enzymatic activity in the presence or absence of TMEM64 is crucial for understanding functional consequences. This can be done by:

    • Microsomal Ca²⁺ uptake assays measuring ATP-dependent ⁴⁵Ca²⁺ uptake

    • Assessing Ca²⁺-dependent ATPase activity in microsomes prepared from wild-type and TMEM64-deficient cells

  • Domain Mapping: To identify specific interaction regions, researchers should perform deletion and point mutation analysis of both TMEM64 and SERCA2, followed by co-IP experiments.

  • Functional Reconstitution: For definitive evidence, reconstitute purified TMEM64 and SERCA2 proteins in liposomes and measure SERCA2 activity to establish direct modulation independent of other cellular factors.

Research has shown that TMEM64 directly associates with SERCA2 and modulates its activity, which is critical for proper calcium oscillation during osteoclastogenesis . These techniques enable detailed characterization of this important molecular interaction.

How should researchers design experiments to investigate sex-specific differences in TMEM64 function?

Designing experiments to investigate sex-specific differences in TMEM64 function requires careful consideration of several methodological factors:

  • Animal Model Selection and Analysis:

    • Use balanced cohorts of male and female mice at multiple age points (pre-pubertal, post-pubertal, and adult stages)

    • Analyze bone parameters separately for each sex and age group

    • Include sufficient sample sizes to detect potentially subtle sex-specific differences (typically n≥8-10 per group)

  • Hormone Control and Manipulation:

    • Measure serum levels of sex hormones (estrogen, testosterone) in experimental animals

    • Consider gonadectomy studies (ovariectomy for females, orchidectomy for males) to evaluate TMEM64 function in the absence of sex hormones

    • Include sham-operated controls matched for sex and age

  • Cellular and Molecular Analyses:

    • Isolate and culture bone marrow cells from male and female mice separately

    • Compare TMEM64 expression levels and subcellular localization between sexes

    • Assess RANKL-induced calcium oscillations and downstream signaling in sex-matched comparisons

  • Data Interpretation Guidelines:

    • Always analyze and present data for males and females separately before pooling

    • Test for sex-by-genotype interactions in statistical analyses

    • Consider the influence of sex as a biological variable when interpreting phenotypic differences

This approach is particularly important given that studies with Transferrin receptor 1 (Tfr1) conditional knockout mice have demonstrated significant sex-specific differences in bone phenotypes, with female mice showing more pronounced increases in trabecular bone mass compared to males . Similar patterns might exist for TMEM64, where sex hormones could potentially modulate its expression or function in bone cells.

How does TMEM64 regulate RANKL-induced signaling pathways in osteoclast differentiation?

TMEM64 exerts specific regulatory control over RANKL-induced signaling pathways during osteoclast differentiation, with particular emphasis on calcium-dependent mechanisms rather than canonical MAPK or NF-κB pathways:

  • Selective Pathway Regulation: Research has demonstrated that TMEM64 deficiency does not significantly affect the activation of ERK, p38, JNK, NF-κB, or AKT pathways following RANKL stimulation . These TRAF6-dependent signaling axes remain intact in TMEM64-knockout cells, indicating that TMEM64 functions through alternative mechanisms.

  • Calcium-CaMKIV-CREB Axis: The primary regulatory role of TMEM64 appears to be in the calcium-CaMKIV-CREB signaling pathway:

    • TMEM64 modulates RANKL-induced [Ca²⁺]i oscillation through its interaction with SERCA2

    • This calcium oscillation is critical for activating CaMKIV

    • CaMKIV activation leads to CREB phosphorylation, which is significantly suppressed in TMEM64-deficient BMMs

    • The CREB transcription factor is necessary for the expression of key osteoclastogenic genes

  • Transcriptional Regulation: TMEM64 deficiency results in decreased expression of c-fos and NFATc1, which are master transcriptional regulators of osteoclast differentiation . This transcriptional defect is consistent with impaired calcium signaling, as both factors are regulated by calcium-dependent mechanisms.

  • Mitochondrial ROS Production: TMEM64 is also required for RANKL-induced production of mitochondrial reactive oxygen species (ROS), which was substantially inhibited in TMEM64-deficient cells . This connects TMEM64 to mitochondrial metabolic pathways that support osteoclast differentiation.

  • PGC1β Regulation: The expression of PGC1β, which follows mitochondrial ROS production and CREB activation, was suppressed in TMEM64-deficient cells . This further reinforces TMEM64's role in coordinating calcium signaling with mitochondrial function in osteoclasts.

By selectively modulating calcium oscillations without affecting early RANKL signaling events, TMEM64 serves as a specialized regulatory node in osteoclast differentiation, coordinating calcium dynamics, transcription factor activation, and mitochondrial metabolism.

What are the interconnections between TMEM64 and mitochondrial function in osteoclasts?

The relationship between TMEM64 and mitochondrial function in osteoclasts represents an important aspect of cellular energy metabolism during differentiation:

  • Mitochondrial ROS Production: TMEM64 plays a critical role in regulating mitochondrial reactive oxygen species (ROS) production in response to RANKL stimulation. Studies have shown that TMEM64-deficient cells exhibit substantially inhibited production of mitochondrial ROS after RANKL stimulation for 6 hours . This was demonstrated using mitochondrial ROS-specific dye (MitoSOX) staining, which revealed significantly reduced signal in TMEM64-knockout cells.

  • Calcium-Mitochondria Crosstalk: The impaired calcium oscillations in TMEM64-deficient cells directly impact mitochondrial function. Calcium signaling is known to regulate mitochondrial metabolism, and disruptions in this signaling can alter mitochondrial activity and ROS generation. The research findings suggest that TMEM64-mediated calcium oscillations are upstream of mitochondrial ROS production .

  • PGC1β Expression: PGC1β, a key regulator of mitochondrial biogenesis and function, shows suppressed upregulation in TMEM64-deficient cells following RANKL stimulation . This transcriptional regulator normally increases following mitochondrial ROS production and CREB activation, suggesting that the TMEM64-calcium-mitochondria axis ultimately influences nuclear gene expression patterns.

  • Comparison with Other Metabolic Regulators: Similar to TMEM64, other metabolic regulators such as Transferrin receptor 1 (Tfr1) have been shown to influence mitochondrial function in osteoclasts. Tfr1-deficient osteoclasts display decreased mitochondrial ROS production, particularly pronounced in mature osteoclasts . This suggests that both iron metabolism and calcium signaling converge on mitochondrial function during osteoclastogenesis.

  • Rescue Experiments: When TMEM64-deficient BMMs were infected with retroviral TMEM64 (MSCV-TMEM64), both calcium oscillation and mitochondrial ROS production were dramatically enhanced following RANKL stimulation . This restoration of function confirms that TMEM64 is required for proper mitochondrial activity during osteoclast differentiation.

These findings collectively establish that TMEM64 serves as an important link between calcium signaling and mitochondrial energy metabolism during osteoclast differentiation, coordinating cellular bioenergetics with differentiation signals.

How can researchers distinguish between direct and indirect effects of TMEM64 on bone metabolism?

Distinguishing between direct and indirect effects of TMEM64 on bone metabolism requires a multi-faceted experimental approach:

  • Cell-Specific Conditional Knockout Models:

    • Generate conditional knockout mice using different cell-specific Cre lines (e.g., Lyz2-Cre for myeloid cells, Ctsk-Cre for mature osteoclasts, Col1a1-Cre for osteoblasts)

    • Compare phenotypes between these models to identify cell-autonomous versus non-autonomous effects

    • This approach can reveal whether TMEM64 effects are intrinsic to specific bone cell types

  • Ex Vivo and Co-Culture Systems:

    • Perform osteoclast differentiation assays with BMMs from TMEM64-knockout mice in isolation

    • Conduct co-culture experiments with wild-type or TMEM64-deficient osteoblasts and osteoclast precursors

    • Research has shown that TMEM64-deficient BMMs showed impaired osteoclast generation regardless of whether they were co-cultured with wild-type or TMEM64-deficient osteoblasts, indicating a cell-intrinsic defect

  • Molecular Pathway Analysis:

    • Examine downstream molecular changes in TMEM64-deficient cells using transcriptomics, proteomics, and phosphoproteomics

    • Map identified changes to known signaling pathways using pathway enrichment analysis

    • Distinguish primary (immediate) from secondary (downstream) effects through time-course studies

  • Rescue Experiments:

    • Re-express TMEM64 in knockout cells and assess rescue of phenotypes

    • Use structure-function mutants to identify critical domains responsible for specific effects

    • The successful restoration of calcium oscillation and mitochondrial ROS production in TMEM64-deficient cells after viral TMEM64 expression provides strong evidence for direct causality

  • In Vivo Bone Turnover Assessment:

    • Measure serum bone turnover markers (e.g., TRACP-5b, CTX-I, PINP) to distinguish between effects on bone formation versus resorption

    • Perform dynamic histomorphometry with fluorescent labels to quantify bone formation rates

    • Studies have shown that serum TRACP-5b, an early marker of osteoclast formation, was reduced in TMEM64 mutant mice, confirming effects on osteoclastogenesis

By systematically applying these approaches, researchers can differentiate between direct effects of TMEM64 on calcium signaling and osteoclast differentiation versus indirect effects on other aspects of bone metabolism, including potential compensatory mechanisms that may emerge in response to TMEM64 deficiency.

How do the phenotypes of TMEM64-deficient models compare with other calcium signaling regulators in bone?

Comparing TMEM64-deficient models with other calcium signaling regulators provides valuable insights into the specific role of TMEM64 within the broader calcium signaling network in bone:

These comparative analyses highlight how different regulatory pathways (calcium signaling through TMEM64, iron metabolism through Tfr1) can converge on similar downstream effects in bone metabolism, while also revealing the unique position of TMEM64 within the calcium signaling network that governs osteoclast differentiation.

What methodological approaches can researchers use to study TMEM64 in human bone disease models?

Investigating TMEM64 in human bone disease contexts requires a translational research framework that bridges basic and clinical research:

  • Human Sample Analysis:

    • Tissue Collection Protocol: Obtain bone biopsies from patients with various bone disorders (osteoporosis, Paget's disease, osteopetrosis) and healthy controls. Preserve samples in appropriate fixatives for both protein and RNA analysis.

    • TMEM64 Expression Profiling: Perform immunohistochemistry, in situ hybridization, and RT-qPCR to quantify TMEM64 expression levels in different bone cell populations.

    • Single-Cell Analysis: Apply single-cell RNA sequencing to identify cell-specific expression patterns of TMEM64 and correlated genes in human bone marrow samples.

  • Patient-Derived Cell Models:

    • Primary Cell Isolation: Isolate peripheral blood monocytes from patients and differentiate them into osteoclasts in vitro using M-CSF and RANKL.

    • Calcium Imaging: Implement the same calcium imaging protocols used in mouse studies to assess whether TMEM64-related calcium signaling abnormalities are present in patient-derived cells.

    • CRISPR-Cas9 Modification: Generate isogenic patient-derived cell lines with TMEM64 knockouts or specific mutations to directly test functional consequences.

  • iPSC-Based Disease Modeling:

    • iPSC Generation: Reprogram patient cells to induced pluripotent stem cells (iPSCs).

    • Directed Differentiation: Develop protocols to differentiate iPSCs into osteoclast precursors and mature osteoclasts.

    • 3D Bone Organoids: Establish bone organoid cultures that incorporate multiple cell types to model TMEM64 function in a complex tissue environment.

  • Genetic Association Studies:

    • Variant Identification: Screen for TMEM64 variants in patient cohorts with bone disorders using targeted sequencing.

    • Functional Validation: Test identified variants through in vitro expression studies to assess effects on calcium signaling and osteoclast differentiation.

    • Genotype-Phenotype Correlation: Correlate TMEM64 variants with bone mineral density, fracture risk, and bone turnover markers.

  • Preclinical Therapeutic Testing:

    • Small Molecule Screening: Identify compounds that modulate TMEM64-SERCA2 interactions or downstream calcium signaling.

    • Humanized Mouse Models: Generate mouse models with human TMEM64 variants to test therapeutic approaches in vivo.

    • Biomarker Development: Establish whether circulating markers of TMEM64 activity could serve as diagnostic or therapeutic monitoring tools.

By implementing these methodological approaches, researchers can translate findings from basic TMEM64 studies in mouse models to human bone pathophysiology, potentially uncovering new therapeutic targets for bone disorders characterized by dysregulated osteoclast activity.

What are the common technical challenges in generating and validating TMEM64 recombinant proteins?

Generating and validating recombinant human TMEM64 presents several technical challenges that researchers should anticipate and address:

  • Expression System Selection:

    • Bacterial Systems: While economical, bacterial expression often results in misfolded transmembrane proteins. If attempted, use specialized E. coli strains (e.g., C41(DE3), C43(DE3)) designed for membrane protein expression.

    • Mammalian Expression: HEK293 or CHO cells typically yield properly folded TMEM64 but at lower quantities. Consider using stable cell lines for consistent production.

    • Insect Cell Systems: Baculovirus-infected insect cells often provide a good compromise between proper folding and yield for transmembrane proteins.

  • Construct Design Considerations:

    • Tags and Fusion Partners: Include N-terminal or C-terminal affinity tags (His6, FLAG, etc.) to facilitate purification. Position tags carefully to avoid interfering with protein topology.

    • Signal Sequence Modification: Optimize signal sequences to improve membrane insertion and processing.

    • Truncation Constructs: Generate domain-specific constructs to overcome expression challenges of the full-length protein.

  • Purification Challenges:

    • Detergent Selection: Test multiple detergents (DDM, LMNG, Digitonin) for optimal solubilization while maintaining protein activity. A detergent screen is highly recommended.

    • Purification Strategy: Implement multi-step purification protocols combining affinity chromatography with size exclusion to achieve high purity.

    • Stability Assessment: Monitor protein stability over time using dynamic light scattering or thermal shift assays to optimize buffer conditions.

  • Validation Approaches:

    • Functional Assays: Develop SERCA2 interaction assays to confirm biological activity of the recombinant protein.

    • Structural Integrity: Use circular dichroism or limited proteolysis to assess proper folding.

    • Mass Spectrometry: Perform intact mass analysis and peptide mapping to confirm protein sequence and post-translational modifications.

  • Common Pitfalls and Solutions:

    • Aggregation Issues: If aggregation occurs, adjust detergent concentration, add glycerol (5-10%), or use amphipols for stabilization.

    • Low Expression Yields: Optimize codon usage for the expression system and consider using chaperone co-expression.

    • Proteolytic Degradation: Include protease inhibitors throughout purification and consider screening for more stable constructs through limited proteolysis experiments.

By addressing these technical challenges systematically, researchers can generate functional recombinant TMEM64 suitable for biochemical and structural studies, enabling detailed investigation of its interactions with SERCA2 and other binding partners.

How can researchers quantitatively assess osteoclast phenotypes in TMEM64 studies?

Quantitative assessment of osteoclast phenotypes is critical for understanding TMEM64 function. The following methodological framework enables comprehensive characterization:

  • In Vitro Osteoclastogenesis Quantification:

    • TRAP Staining Protocol: Fix cells with 3.7% formaldehyde for 10 minutes, stain for TRAP activity using a commercial kit (e.g., Sigma-Aldrich), and counterstain with hematoxylin.

    • Standardized Counting Method: Define multinucleated (≥3 nuclei) TRAP-positive cells as mature osteoclasts. Count at least 5 random fields per well and at least 3 wells per condition.

    • Morphometric Analysis: Measure osteoclast size, number of nuclei per osteoclast, and fusion index (percentage of nuclei in multinucleated cells relative to total nuclei) .

  • Functional Assessment of Osteoclast Activity:

    • Resorption Assay Protocol: Culture osteoclasts on dentine slices or commercial bone substrates for 48-72 hours. Remove cells, stain resorption pits with toluidine blue, and quantify pit area using imaging software.

    • Normalized Analysis: Calculate both total resorbed area and resorption per osteoclast to distinguish between effects on differentiation versus activity. Research has shown that TMEM64-deficient BMMs produced smaller pit areas, but no difference in pit area per osteoclast size was observed, indicating primary effects on differentiation rather than resorptive function .

  • Molecular Marker Quantification:

    • Gene Expression Analysis: Perform RT-qPCR for osteoclast markers (NFATc1, OSCAR, ctsk, TRAP) using validated primers and appropriate housekeeping genes.

    • Protein Expression: Quantify protein levels by Western blotting with densitometric analysis normalized to loading controls.

    • **Studies have demonstrated significantly lower levels of NFATc1, OSCAR, ctsk, and ppargc1b in TMEM64-deficient cells, providing molecular signatures of impaired differentiation .

  • In Vivo Bone Phenotyping:

    • μCT Protocol: Scan femurs at high resolution (10-12 μm voxel size) and analyze standard parameters (BV/TV, Tb.N, Tb.Th, Tb.Sp) using specialized software.

    • Histomorphometry Standards: Prepare undecalcified sections stained for TRAP activity. Quantify osteoclast number per bone perimeter (Oc.N/B.Pm) and osteoclast surface per bone surface (Oc.S/BS) using standardized histomorphometric software .

    • Serum Biomarkers: Measure serum TRACP-5b (osteoclast number marker) and CTX-I (bone resorption marker) using commercial ELISA kits .

  • Dynamic Parameters and Time-Course Analysis:

    • Proliferation Assay: Assess cell proliferation using BrdU incorporation or Ki67 staining to distinguish differentiation defects from proliferation abnormalities .

    • Apoptosis Measurement: Quantify apoptosis rates using Annexin V staining or TUNEL assays to rule out cell survival effects .

    • Time-Course Design: Analyze osteoclast parameters at multiple time points (24h, 48h, 72h, 96h) to distinguish delays in differentiation from complete blocks.

This comprehensive quantitative framework allows researchers to precisely characterize how TMEM64 influences osteoclast biology across multiple parameters, enabling robust comparisons between experimental conditions.

What are the major unresolved questions in TMEM64 research?

Despite significant advances in understanding TMEM64 function, several critical questions remain unresolved that present important opportunities for future research:

  • Structural Mechanisms of TMEM64-SERCA2 Interaction:

    • The precise molecular mechanism by which TMEM64 modulates SERCA2 activity remains unclear

    • Structural studies to determine the interaction domains and conformational changes induced by TMEM64 binding to SERCA2 are needed

    • Understanding how this interaction specifically affects calcium pump function at the molecular level would provide fundamental mechanistic insights

  • Tissue-Specific Functions Beyond Bone:

    • TMEM64 expression is not limited to the skeletal system, yet its functions in other tissues remain largely unexplored

    • Investigation of TMEM64's role in calcium homeostasis across different cell types could reveal broader physiological importance

    • Whether TMEM64 interacts with other calcium-regulating proteins in different cellular contexts is unknown

  • Sex-Specific Regulation and Function:

    • The molecular basis for potential sex-specific differences in TMEM64 function, similar to those observed with Tfr1, requires clarification

    • Whether sex hormones directly regulate TMEM64 expression or function remains to be determined

    • Understanding these differences could explain sex-specific prevalence of certain bone disorders

  • Therapeutic Targeting Potential:

    • The feasibility of targeting the TMEM64-SERCA2 interaction for therapeutic applications in bone disorders needs assessment

    • Whether small molecules can selectively modulate this interaction without disrupting other calcium homeostasis mechanisms is unknown

    • The potential systemic effects of TMEM64 modulation beyond bone remain unclear

  • Integration with Other Metabolic Pathways:

    • How TMEM64-mediated calcium signaling integrates with other metabolic pathways, such as iron metabolism via Tfr1, requires further investigation

    • The convergence of these pathways on mitochondrial function suggests complex regulatory networks that remain to be fully mapped

    • Whether TMEM64 function is altered under different metabolic conditions (e.g., nutrient restriction, oxidative stress) is poorly understood

Addressing these unresolved questions will require interdisciplinary approaches combining structural biology, advanced imaging, genetic models, and systems biology perspectives to fully elucidate TMEM64's role in calcium signaling, bone metabolism, and potentially broader physiological processes.

How does current TMEM64 research inform potential therapeutic applications in bone disorders?

Current TMEM64 research provides several promising avenues for therapeutic development in bone disorders, particularly those characterized by excessive osteoclast activity:

  • TMEM64 as a Therapeutic Target:

    • The increased bone mass phenotype observed in TMEM64-deficient mice suggests that inhibiting TMEM64 function could potentially prevent pathological bone loss

    • The specific interaction between TMEM64 and SERCA2 offers a defined molecular target for drug development

    • Small molecule inhibitors or peptide-based therapeutics that disrupt this interaction could represent novel anti-resorptive agents with a distinct mechanism of action from current therapies

  • Calcium Signaling Modulation:

    • Understanding how TMEM64 regulates calcium oscillations provides mechanistic insights for developing therapies that modulate calcium signaling in osteoclasts

    • Since TMEM64 deficiency impairs RANKL-induced calcium oscillation without affecting other RANKL signaling pathways, targeted intervention may produce fewer off-target effects than broader approaches

    • Combination therapies targeting multiple nodes in calcium signaling networks might offer synergistic benefits

  • Biomarker Development:

    • Changes in TMEM64 expression or downstream signaling molecules could serve as biomarkers for disease progression or treatment response

    • Monitoring calcium signaling parameters in patient-derived osteoclast precursors might predict individual responses to specific therapies

    • Integration with other biomarkers of bone turnover could enhance diagnostic and prognostic capabilities

  • Sex-Specific Therapeutic Approaches:

    • The emerging evidence of sex-specific differences in bone phenotypes related to calcium and iron metabolism pathways suggests that therapeutic approaches might need to be tailored according to gender

    • Hormone-specific modulation of TMEM64 function could be investigated, particularly for postmenopausal osteoporosis

  • Mitochondrial Targeting:

    • The connection between TMEM64, calcium signaling, and mitochondrial ROS production identifies mitochondria as a downstream target for therapeutic intervention

    • Compounds that specifically modulate mitochondrial function in osteoclasts might complement therapies targeting TMEM64 directly

    • Combined approaches addressing both calcium signaling and mitochondrial metabolism could provide more comprehensive control of osteoclast differentiation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.