Recombinant Human Transmembrane protein 70, mitochondrial (TMEM70)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
TMEM70; Transmembrane protein 70, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
82-260
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
TMEM70
Target Protein Sequence
LNTPSDKSEDGRLIYTGNMARAVFGVKCFSYSTSLIGLTFLPYIFTQNNAISESVPLPIQ IIFYGIMGSFTVITPVLLHFITKGYVIRLYHEATTDTYKAITYNAMLAETSTVFHQNDVK IPDAKHVFTTFYAKTKSLLVNPVLFPNREDYIHLMGYDKEEFILYMEETSEEKRHKDDK
Uniprot No.

Target Background

Function

TMEM70 is involved in the biogenesis of the mitochondrial ATP synthase complex.

Gene References Into Functions

TMEM70's Role in Mitochondrial ATP Synthase Biogenesis: Evidence from the Literature

  1. Association of TMEM70 mutations with a Chinese family exhibiting dual long QT syndrome type 1 (LQT1) and hypertrophic cardiomyopathy (HCM) phenotypes, alongside mutations in KCNQ1, MYH7, MYLK2. PMID: 25825456
  2. TMEM70 mutations cause distinct mitochondrial ultrastructural degeneration and nearly complete ATP synthase deficiency, yet remain treatable. PMID: 26550569
  3. TMEM70 deficiency is a multisystemic disorder with variable outcomes, largely dependent on effective management of hyperammonemic crises in early life. PMID: 25326274
  4. Rare association of pulmonary hypertension with TMEM70 deficiency reported in a single patient. PMID: 24485043
  5. TMEM70's function in ATP synthase biogenesis may involve interactions with other proteins. PMID: 24576557
  6. Mutant TMEM70 forms high-molecular-weight complexes (470-550 kDa) in Hela cells, directly impacting ATP synthase biogenesis and assembly by mediating F1 subunit incorporation. PMID: 22986587
  7. Fibroblasts from TMEM70-mutated patients show significant ATP synthase reduction (82-89%) and increased levels of respiratory chain complexes III and IV. PMID: 22433607
  8. Observation of fragmented mitochondrial networks and altered mitochondrial morphology in fibroblasts from a patient with a TMEM70 deletion. PMID: 21945727
  9. TMEM70 mutations contribute to 3-methylglutaconic aciduria across diverse populations. PMID: 21815885
  10. TMEM70 defects identified as a common cause of nuclear-origin ATP synthase deficiency. PMID: 21147908
  11. Mitochondrial nucleoid disorganization associated with TMEM70 deficiency. PMID: 20920610
  12. Absence of TMEM70 protein in cells and mitochondria of patients with ATP synthase deficiency due to a specific TMEM70 mutation. PMID: 20937241
  13. Consideration of TMEM70 mutations in diagnosing neonates with hypotonia, cardiomyopathy, and other symptoms. PMID: 20335238
  14. TMEM70's role in mitochondrial ATP synthase biogenesis in higher eukaryotes. PMID: 18953340
  15. Identification of TMEM70 mutations as a cause of hypertrophic cardiomyopathy and encephalopathy. PMID: 19103153
Database Links

HGNC: 26050

OMIM: 612418

KEGG: hsa:54968

STRING: 9606.ENSP00000312599

UniGene: Hs.106650

Involvement In Disease
Mitochondrial complex V deficiency, nuclear 2 (MC5DN2)
Protein Families
TMEM70 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of human TMEM70 protein?

TMEM70 is a mitochondrial inner membrane protein characterized by a cleavable N-terminal mitochondrial targeting sequence, two transmembrane segments, and a C-terminal hydrophilic domain. The precursor form has a molecular weight of approximately 29 kDa, while the mature protein (after cleavage of the targeting sequence) is approximately 20.7 kDa . Sequence analysis reveals that the protein adopts a membrane-spanning topology with defined hydrophobic regions that anchor it within the inner mitochondrial membrane. When designing recombinant constructs, researchers should consider these structural features to ensure proper protein folding and function.

Where is TMEM70 localized within mitochondria?

TMEM70 is specifically localized to the inner mitochondrial membrane within cristae structures. Expansion microscopy studies have shown that TMEM70 does not co-localize with MIC60 (a MICOS complex component) at the mitochondrial periphery but instead distributes to structures that span the entire mitochondrial width, consistent with localization to mitochondrial cristae . This spatial organization is critical for its function in ATP synthase assembly. When designing immunofluorescence experiments to detect recombinant TMEM70, researchers should use appropriate mitochondrial markers that can distinguish between different mitochondrial compartments.

What is the primary function of TMEM70 in mitochondria?

TMEM70 primarily functions as an assembly factor for the mitochondrial ATP synthase, specifically promoting the integration of subunit c into the inner mitochondrial membrane and the formation of c8-rings . It selectively interacts with the c-subunit from among the 18 types of subunits present in the ATP synthase, forming high molecular mass complexes with the c-subunit in the range of 60 to 150 kDa . Knockdown studies demonstrate that reduced TMEM70 expression leads to decreased amounts of functional ATP synthase , although the ATP synthase can still be assembled in its absence, albeit at lower levels .

How does TMEM70 interact with TMEM242 in ATP synthase assembly?

TMEM70 and TMEM242 have similar and overlapping functions in the assembly of c8-rings in ATP synthase. When tagged TMEM242 and TMEM70 were expressed separately in HEK293 cells, they were found to associate with each other and with common proteins, including ACAD9, ECSIT, and NDUFAF1, which are components of the MCIA complex (Mitochondrial Complex I Assembly complex) . While TMEM70 primarily influences c8-ring assembly, TMEM242 additionally affects the incorporation of subunits ATP6, ATP8, j, and k into the ATP synthase . This suggests that TMEM242 is required for terminal assembly steps that occur after the incorporation of the c8-ring, whereas TMEM70 is more specifically involved in c8-ring formation.

What is the evidence that TMEM70 forms oligomeric scaffolds?

Native gel analyses have shown that TMEM70 exists in oligomeric forms with molecular masses ranging up to and beyond 1,236 kDa . These high-molecular-weight complexes may represent oligomeric scaffolds that aid in c8-ring assembly . When TMEM70-tagged proteins were affinity-purified, subunit c was found exclusively in smaller complexes with molecular masses in the range from 60 to 150 kDa, and TMEM70 co-migrated with a subunit c complex of approximately 150 kDa . These findings suggest that TMEM70 oligomers provide a structural platform for the assembly of the c-ring component of ATP synthase within the inner cristae membranes .

How do mutations in TMEM70 affect mitochondrial function and clinical presentation?

Multiple mutations in the TMEM70 gene have been identified in patients with mitochondrial encephalocardiomyopathy. The most common mutation is c.317-2A>G, which can be found in homozygosity or as a compound heterozygous mutation with other TMEM70 variants . Novel mutations include missense mutations (e.g., c.701A>C, p.His234Pro), nonsense mutations (e.g., c.238C>T, p.Arg80*), microdeletions (e.g., c.349_352del, p.Ile117Alafs*36), and mutations affecting the termination codon (e.g., c.783A>G, p.261Trpext17) .

Patients with TMEM70 mutations typically present with severe clinical features including hypertrophic cardiomyopathy, psychomotor retardation, hypotonia, and 3-methylglutaconic aciduria . Brain MRI findings may include bulbar and cerebellar atrophy, pseudocysts in frontal or occipital lobes, signs of incomplete brain development, and in some cases severe hemorrhagic lesions . Biochemically, these mutations generally result in isolated complex V (ATP synthase) deficiency, although complex I deficiency has also been observed in some cases .

What approaches are effective for recombinant expression and detection of TMEM70?

For recombinant expression of TMEM70, researchers have successfully used lentiviral vectors co-expressing fluorescent markers such as mitoDsRed for mitochondrial targeting . This approach allows for FACS sorting of transduced cells to obtain homogeneous populations stably expressing TMEM70. For protein detection, antibodies can be generated against peptides located upstream of the transmembrane segments and at the C-terminus .

When expressing tagged versions of TMEM70, the FLAG tag has been successfully used for immunoprecipitation and detection by expansion microscopy . It is crucial to validate the functionality of recombinant TMEM70 constructs by assessing their ability to restore ATP synthase assembly in TMEM70-deficient cells.

How can researchers assess ATP synthase assembly and function in TMEM70 studies?

Multiple approaches can be used to evaluate ATP synthase assembly and function:

  • Blue Native Gel Electrophoresis (BNGE) followed by Western blotting to assess the presence and quantity of assembled ATP synthase complexes .

  • ATPase activity assays in digitonin-treated fibroblasts, which have been shown to reliably detect reductions in complex V activity in TMEM70-deficient cells .

  • Spectrophotometric analysis for complex V (ATP hydrolysis), though this method may have limitations in frozen muscle samples due to insufficient reliability and the presence of oligomycin-insensitive ATPase activity in cultured cells .

  • Immunodetection of TMEM70 in total lysates from fibroblasts or tissue samples to confirm the presence or absence of the protein .

What techniques are available for studying TMEM70 interactions with other proteins?

To investigate TMEM70's interactions with other proteins, researchers have employed:

  • Affinity purification of tagged TMEM70 followed by mass spectrometry to identify interacting partners. This approach has revealed associations with ACAD9, ECSIT, NDUFAF1, and TMEM126B (components of the MCIA complex), as well as with subunit c of ATP synthase and several membrane subunits of complex I .

  • Co-immunoprecipitation followed by immunoblotting to confirm specific interactions. For example, TMEM70-t has been found in association with ACAD9, NDUFAF1, and TIMMDC1, as well as with subunit c .

  • Native gel analyses to study the formation of protein complexes. This technique has shown that TMEM70-t co-migrates with a subunit c complex of approximately 150 kDa, while TMEM70 itself forms higher molecular weight oligomers .

How can researchers reconcile the dual role of TMEM70 in ATP synthase and complex I assembly?

The data presents an interesting challenge in understanding TMEM70's multiple functions. While TMEM70 primarily influences ATP synthase assembly, deletion of TMEM70 also reduces complex I levels . This dual effect requires careful experimental design to distinguish direct and indirect effects.

Two possible explanations have been proposed:

To address this question experimentally, researchers could perform time-course studies of complex assembly, utilize proximity labeling techniques to map dynamic interactions, or develop in vitro reconstitution systems to test direct assembly roles.

What are the potential pitfalls in measuring ATP synthase activity in TMEM70 research?

When assessing ATP synthase activity in the context of TMEM70 research, several methodological challenges should be considered:

  • The spectrophotometric analysis for complex V (ATP hydrolysis) may be unreliable in frozen muscle samples, as normal values have been obtained in samples with nearly absent complex V holocomplexes as assessed by BNGE Western blot .

  • ATPase activity measurements in cultured cells can be complicated by the presence of oligomycin-insensitive ATPase activity .

  • Often, spectrophotometric analysis for complex V is not performed due to these reliability issues .

To obtain more reliable results, researchers should:

  • Use ATPase activity measurements in digitonin-treated fibroblasts, which have been shown to be reliable in detecting complex V deficiency .

  • Combine functional assays with structural analyses such as BNGE Western blotting to assess the presence and quantity of assembled ATP synthase complexes.

  • Consider in-gel ATPase activity assays following BNGE to directly correlate complex formation with functional activity.

How should researchers interpret the varying effects of different TMEM70 mutations?

The interpretation of different TMEM70 mutations presents challenges due to the range of biochemical and clinical phenotypes observed. Some key considerations include:

  • All identified TMEM70 mutations, including novel variants, appear to result in virtual absence of TMEM70 protein in patient samples , suggesting a common mechanism of protein loss despite different mutation types.

  • Most TMEM70 mutations lead to isolated complex V deficiency, but some patients (e.g., P10) may present with isolated complex I defects , indicating potential variability in the pathophysiological mechanisms.

  • Clinical presentations can vary in severity and specific features, with some patients exhibiting additional symptoms such as subacute intestinal obstruction .

To address these challenges, researchers should:

  • Perform comprehensive genotype-phenotype correlation studies across multiple patients.

  • Utilize cellular models expressing different TMEM70 mutations to directly compare their effects on protein stability, localization, and function.

  • Consider the potential influence of genetic modifiers and environmental factors that may contribute to phenotypic variability.

What are the emerging hypotheses about TMEM70's role in mitochondrial translation?

Recent research suggests that TMEM70 may have functions beyond its role in c8-ring assembly. The C-terminal region of yeast Mrx15, the ortholog of TMEM70, interacts with the large subunit of the mitochondrial ribosome , suggesting that TMEM70 may also be involved in the translation and membrane insertion of mitochondrially encoded ATP synthase subunits such as ATP6 and ATP8 . This potential role in translation could explain why TMEM70, along with TMEM242, influences not only c8-ring formation but also the incorporation of other subunits into the ATP synthase complex.

To investigate this hypothesis, researchers could:

  • Perform ribosome profiling experiments to assess the impact of TMEM70 depletion on mitochondrial translation.

  • Use proximity labeling approaches to identify potential interactions between TMEM70 and mitochondrial translation machinery components.

  • Develop assays to directly measure the translation and membrane insertion of mitochondrially encoded ATP synthase subunits in the presence and absence of TMEM70.

How might the oligomeric structure of TMEM70 contribute to its function?

The observation that TMEM70 forms high-molecular-weight oligomers raises important questions about the structural basis of its function. These oligomeric structures may provide a scaffold for c8-ring assembly , but the precise mechanism remains unclear.

Future research directions could include:

  • Structural studies using cryo-electron microscopy to determine the three-dimensional architecture of TMEM70 oligomers.

  • Mutagenesis experiments to identify regions of TMEM70 critical for oligomerization and correlation with functional defects.

  • In vitro reconstitution studies to directly observe TMEM70-mediated c8-ring assembly in defined membrane environments.

What therapeutic approaches might be effective for TMEM70-related disorders?

Based on our understanding of TMEM70 function, several therapeutic approaches could be considered for TMEM70-related disorders:

Testing these approaches would require appropriate cellular and animal models of TMEM70 deficiency, coupled with robust outcome measures for ATP synthase assembly and function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.