Recombinant Human Transmembrane protein 72 (TMEM72)

What is the basic structure of TMEM72?

TMEM72 is characterized by four transmembrane domains (TMDs) and a long C-terminal tail. The protein consists of 275 amino acids with a molecular mass of approximately 36.9 kDa . The full amino acid sequence is:

MQLQVFWTGLEYTCRLLGITTAAVLIGVGTETFLQGQFKSLAFYLLFTGAAVSICEGAYFVAQLLAICFQCQPGSLADRVREKAHWLGCFQKFLAYLLLSVACFLHPVLVWHVTIPGSMLIITGLAYFLLSKRKKRKAAPEVLASPEQYTDPSSSAVSTTGSGDTEQTYTFHGALKEGPSSLFIHMKSILKGTKKPSALQPPNTLMELSLEPADSLAKKKQVHFEDNLVRIVPSLAEGLDDGDSEPEETTSDTTPIIPPPQAPLFLSSLTATGLF

The TMDs are essential for proper protein folding and assembly, while the C-terminal region plays a crucial role in protein transport . Experimental deletion mutant studies have confirmed that the TMDs are necessary for appropriate protein folding or assembly, highlighting their structural importance .

What is the cellular localization of TMEM72?

Immunofluorescence analysis has demonstrated that TMEM72 is primarily localized on the plasma membrane. It is specifically not found on the outer mitochondrial membrane, distinguishing it from some other transmembrane proteins . The precise localization is important for TMEM72's function in cellular transport processes. The protein's trafficking from the endoplasmic reticulum to the plasma membrane involves COPII-dependent processes, which are mediated by specific motifs in the C-terminal region of the protein .

What physiological roles does TMEM72 play in normal tissue function?

TMEM72 is involved in normal kidney development, suggesting a specialized role in renal tissue formation and function . While the specific physiological mechanisms remain under investigation, its plasma membrane localization suggests involvement in cellular transport processes, particularly those mediated by its C-terminal region . The protein is part of the broader transmembrane protein family, many members of which have emerged as important players in various physiological processes, including cellular communication and signal transduction across membranes .

What expression systems are commonly used for producing recombinant TMEM72?

Multiple expression systems have been successfully employed for producing recombinant TMEM72. Based on the available data, three main systems have been documented:

• E. coli in vitro expression system: Used for producing recombinant human TMEM72 with N-terminal His tag and C-terminal Myc tag (amino acids 1-275) .

• HEK-293 Cells: Mammalian expression system used for producing full-length TMEM72 protein with His tag, achieving >90% purity as determined by Bis-Tris PAGE and other analytical methods .

• Cell-free protein synthesis (CFPS): This system has also been employed for TMEM72 production with alternative tags such as Strep Tag .

For transmembrane proteins like TMEM72, mammalian expression systems often provide advantages for proper folding and post-translational modifications, though bacterial systems may offer higher yield for certain applications .

What purification approaches yield highest quality TMEM72 protein?

The most effective purification approach for recombinant TMEM72 involves one-step affinity chromatography, particularly when the protein includes affinity tags such as His-tag or Strep-tag . This method has been documented to yield >90% purity as determined by multiple analytical techniques including:

• Bis-Tris PAGE

• Anti-tag ELISA

• Western Blot

• Analytical SEC (HPLC)

For optimal results, researchers should consider the following purification parameters:

It's important to note that for transmembrane proteins like TMEM72, the purification strategy may need optimization based on the specific experimental requirements and downstream applications .

How can I verify the authenticity and functional integrity of recombinant TMEM72?

Verification of recombinant TMEM72 authenticity and functional integrity should employ multiple complementary approaches:

• Structural Verification:

  • SDS-PAGE analysis to confirm the expected molecular weight (36.9 kDa)

  • Western blotting using antibodies against TMEM72 or the affinity tag

  • Mass spectrometry to confirm the amino acid sequence

• Functional Verification:

  • Immunofluorescence analysis to confirm proper plasma membrane localization

  • Assessment of protein transport function through colocalization studies

  • Evaluation of protein-protein interactions through immunoprecipitation assays, particularly focusing on the C-terminal region interactions

• Folding Assessment:

  • Unfolded protein response (UPR) analysis to ensure proper protein folding has occurred

  • Domain-specific replacement analysis to verify functional domains, particularly the C-terminal region's role in protein transport

Improper folding may activate the UPR pathway, which can be monitored as an indirect indicator of recombinant TMEM72 quality .

What experimental models best demonstrate TMEM72's role in kidney development?

While specific experimental models for TMEM72 in kidney development are not extensively detailed in the provided search results, researchers investigating TMEM72's role in renal development should consider:

• In vitro models:

  • Kidney cell lines (HEK293, RPTEC, or primary renal cells) with TMEM72 overexpression or knockdown

  • 3D organoid models to observe developmental processes

• In vivo models:

  • Genetic knockout or knockdown models

  • Developmental timeline studies to track TMEM72 expression during kidney formation

Experimental approaches should incorporate immunofluorescence analysis to track TMEM72 localization during different developmental stages . Additionally, domain-specific deletion or mutation experiments can help identify which regions of TMEM72 are critical for normal kidney development, with particular attention to the functional domains identified in the C-terminal region .

How does TMEM72 contribute to renal cell carcinoma pathogenesis?

TMEM72 has been implicated in tumorigenesis in renal cell carcinoma (RCC), though the precise mechanisms remain under investigation . Based on the available data, researchers should consider the following aspects when studying TMEM72 in RCC:

• Expression Pattern Analysis:

  • Compare TMEM72 expression levels between normal kidney tissue and RCC samples

  • Correlate expression with clinical parameters (staging, prognosis, treatment response)

• Functional Mechanisms:

  • Investigate how TMEM72's membrane trafficking function might contribute to cancer cell behavior

  • Examine the relationship between TMEM72 and signaling pathways known to be dysregulated in RCC

• Therapeutic Potential:

  • Explore whether targeting TMEM72 or its interacting partners might provide therapeutic benefits

  • Investigate if TMEM72 expression levels could serve as a biomarker for RCC diagnosis or prognosis

The pathogenesis connection may be related to TMEM72's role in membrane trafficking, which is crucial for cells to maintain normal function. Disruption of this process could contribute to RCC development or progression .

What signaling pathways interact with TMEM72's C-terminal transport motifs?

The C-terminal region of TMEM72 contains specific motifs that are crucial for cellular transport. Two key motifs have been identified:

• 132KRKKRK137: Associated with COPII-dependent transport

• 139APEVLA144: Also implicated in membrane trafficking

These motifs, corresponding to amino acid positions 132-144 (KRKKRKAAPEVLA), participate in efficient cellular transport . Researchers investigating the signaling pathways should focus on:

• COPII Interaction Studies:

  • Colocalization experiments with COPII components

  • Immunoprecipitation assays to identify direct interactions

  • Mutagenesis of the key motifs to evaluate their functional significance

• Anterograde Transport Pathway Analysis:

  • Tracking protein movement from ER to plasma membrane

  • Evaluating the role of Sec24 and other COPII components in TMEM72 transport

  • Identifying rate-limiting steps in TMEM72 trafficking

• Comparative Analysis:

  • Compare TMEM72 transport motifs with those of other transmembrane proteins

  • Investigate if these motifs are conserved across species

Understanding these interactions may provide insights into both normal cellular function and disease states, particularly in renal carcinoma and chronic kidney disease contexts .

What techniques are most effective for studying TMEM72 trafficking dynamics?

To effectively study TMEM72 trafficking dynamics, researchers should consider multiple complementary approaches:

• Live Cell Imaging:

  • Fluorescent protein tagging (e.g., GFP-TMEM72 fusion proteins)

  • Pulse-chase experiments to track protein movement

  • FRAP (Fluorescence Recovery After Photobleaching) to analyze membrane dynamics

• Colocalization Studies:

  • Immunofluorescence with markers for different cellular compartments (ER, Golgi, plasma membrane)

  • Confocal microscopy for high-resolution spatial analysis

  • Super-resolution microscopy for nanoscale localization

• Biochemical Approaches:

  • Subcellular fractionation to isolate membrane compartments

  • Surface biotinylation to quantify plasma membrane localization

  • Domain-specific replacement analysis to identify critical regions for trafficking

These techniques have proven valuable in demonstrating that the proximal C-terminal region is responsible for anterograde protein transport of TMEM72 . When designing these experiments, particular attention should be paid to the KRKKRKAAPEVLA sequence (amino acids 132-144) which has been shown to participate in efficient cellular transport .

How can I design experiments to investigate TMEM72 interactions with COPII components?

To investigate interactions between TMEM72 and COPII components, consider the following experimental design approaches:

• Protein-Protein Interaction Studies:

  • Co-immunoprecipitation assays targeting TMEM72 and COPII components (Sec23, Sec24, Sar1)

  • Proximity ligation assays to visualize interactions in situ

  • Yeast two-hybrid or mammalian two-hybrid systems to identify direct interactions

• Functional Analysis:

  • Site-directed mutagenesis of the key motifs (132KRKKRK137 and 139APEVLA144)

  • Dominant-negative approaches using COPII component mutants

  • siRNA knockdown of COPII components followed by TMEM72 trafficking assessment

• Structural Studies:

  • In silico modeling of TMEM72-COPII interactions

  • Cryo-EM or X-ray crystallography of the interacting domains

  • Peptide competition assays to map binding interfaces

The experimental design should particularly focus on how the motifs 132KRKKRK137 and 139APEVLA144 interact with the COPII machinery, as these have been implicated in TMEM72 transport . Controls should include mutated versions of these motifs to confirm specificity of the interactions.

What are the critical controls for experiments investigating TMEM72 function in disease models?

When investigating TMEM72 function in disease models, particularly renal cell carcinoma or chronic kidney disease, the following controls are critical:

• Expression Level Controls:

  • Include both overexpression and knockdown/knockout models

  • Use inducible expression systems to control timing and level of expression

  • Validate antibody specificity with TMEM72-null cells or tissues

• Functional Domain Controls:

  • Include domain deletion mutants, particularly of the C-terminal region

  • Test point mutations in key motifs (132KRKKRK137 and 139APEVLA144)

  • Include trafficking-deficient mutants as negative controls

• Disease Model Validation:

  • Compare multiple cell lines or animal models

  • Include age-matched and sex-matched controls

  • Validate disease phenotypes using established markers

• Technical Controls:

  • Include other TMEM family members to assess specificity

  • Perform rescue experiments to confirm specificity of phenotypes

  • Include unfolded protein response analysis to ensure observed effects are not due to protein misfolding

These controls will help distinguish between effects specifically attributable to TMEM72 function versus secondary effects or artifacts, particularly important given TMEM72's role in both normal kidney development and renal carcinoma .

What are the most promising therapeutic applications of TMEM72 research?

Based on current understanding, TMEM72 research holds potential therapeutic implications in several areas:

• Renal Cell Carcinoma Treatment:

  • Development of targeted therapies against TMEM72 or its regulatory pathways

  • Use of TMEM72 expression as a biomarker for patient stratification or treatment response

  • Investigation of TMEM72's role in resistance to existing RCC therapies

• Chronic Kidney Disease Interventions:

  • Exploration of TMEM72's role in kidney injury and repair mechanisms

  • Development of diagnostic tools based on TMEM72 expression or function

  • Therapeutic approaches targeting TMEM72-dependent trafficking pathways

• Membrane Trafficking Disorders:

  • Broader applications to diseases involving disrupted protein trafficking

  • Use of the TMEM72 C-terminal motifs as templates for developing trafficking-modulating drugs

  • Development of screening platforms for compounds that restore normal trafficking in disease states

The involvement of TMEM72 in both normal kidney development and carcinogenesis makes it a particularly interesting target for therapeutic development, potentially allowing for interventions that specifically target disease states while preserving normal function .

How might TMEM72 interact with other transmembrane proteins in cellular function?

Understanding TMEM72's interactions with other transmembrane proteins represents an important frontier in research. Several potential interaction scenarios warrant investigation:

• TMEM Family Interactions:

  • Examine potential heterodimerization with other TMEM family members

  • Investigate shared trafficking pathways among TMEM proteins

  • Analyze correlation patterns of expression with other TMEMs, similar to patterns observed with TMEM97

• Functional Complexes:

  • Identify potential partners in kidney-specific transport processes

  • Investigate whether TMEM72 forms part of larger signaling complexes

  • Explore interactions with ion channels or transporters relevant to kidney function

• Regulatory Interactions:

  • Study how TMEM72 expression might be influenced by other membrane proteins

  • Investigate competitive or cooperative interactions in membrane trafficking

  • Examine potential regulation of TMEM72 by membrane-associated kinases or phosphatases