Recombinant Human Transmembrane protein 74B (TMEM74B)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested. Advance notification is required for dry ice shipment, and additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TMEM74B; C20orf46; Transmembrane protein 74B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-256
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMEM74B
Target Protein Sequence
MPPAQGYEFAAAKGPRDELGPSFPMASPPGLELKTLSNGPQAPRRSAPLGPVAPTREGVE NACFSSEEHETHFQNPGNTRLGSSPSPPGGVSSLPRSQRDDLSLHSEEGPALEPVSRPVD YGFVSALVFLVSGILLVVTAYAIPREARVNPDTVTAREMERLEMYYARLGSHLDRCIIAG LGLLTVGGMLLSVLLMVSLCKGELYRRRTFVPGKGSRKTYGSINLRMRQLNGDGGQALVE NEVVQVSETSHTLQRS
Uniprot No.

Target Background

Database Links

HGNC: 15893

KEGG: hsa:55321

UniGene: Hs.516834

Protein Families
TMEM74 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TMEM74B and how is it related to TMEM74?

TMEM74B (Transmembrane protein 74B) is a transmembrane protein with structural and functional similarities to TMEM74. While TMEM74 has been more extensively studied and shown to promote autophagy through interactions with ATG16L1 and ATG9A , TMEM74B likely shares some functional properties but with distinct regulatory mechanisms. Both are membrane proteins involved in cellular processes, but further research is needed to fully elucidate the specific functions of TMEM74B compared to its better-characterized counterpart.

What are the common synonyms and identifiers for TMEM74B in research databases?

TMEM74B is referenced in various research databases under several identifiers:

  • Common synonyms: TMEM74B, TMEM74Bp, hTMEM74B

  • Protein identifiers: Q5QPM3, Q9NUR3

  • Database linkouts: STRING, Pharos, UniProt

These alternative identifiers are crucial when conducting comprehensive literature searches or database mining for TMEM74B-related information .

What is known about the genetic structure and organization of TMEM74B?

The TMEM74B gene has been characterized in mouse models using targeted non-conditional alleles (e.g., Tmem74btm1e(KOMP)Wtsi). Genotyping protocols for TMEM74B typically involve multiple PCR reactions to detect the cassette, gene-specific wild type allele, and mutant allele-specific regions. The gene can be targeted using strategies like those employed in the EUCOMM/KOMP projects, with specific primer sequences established for reliable identification and manipulation .

What cellular pathways is TMEM74B involved in?

Based on studies of the related protein TMEM74, it is reasonable to hypothesize that TMEM74B may play a role in autophagy regulation. TMEM74 has been shown to increase the autophagic flux process in tumor cell lines through direct interactions with ATG16L1 and ATG9A, which are responsible for nucleation and elongation in the autophagy process . While direct evidence for TMEM74B's role in these pathways is still emerging, researchers should consider exploring similar interaction patterns when investigating TMEM74B function.

Is TMEM74B expression associated with any specific disease states?

Disease-gene association databases indicate potential links between TMEM74B and various pathological conditions. While specific details remain limited in the available literature, bioinformatic approaches have been used to investigate molecular genetic susceptibility profiles in conditions such as moderate and severe asthma that may involve TMEM74B . Additionally, based on knowledge of the related protein TMEM74, which shows associations with cancer survival rates, researchers should consider investigating TMEM74B expression in various cancer types.

How does TMEM74B expression differ across tissue types?

The tissue-specific expression patterns of TMEM74B remain inadequately characterized in the current literature. A methodological approach to addressing this question would involve analyzing RNA-seq data from tissue atlases or conducting quantitative PCR analysis across multiple tissue samples. Researchers interested in tissue-specific functions should design comparative expression studies using standardized protocols for RNA isolation and quantification to establish baseline expression profiles.

What are the recommended protocols for genotyping TMEM74B in mouse models?

For TMEM74B genotyping in mouse models, a combination of standard PCR reactions is recommended:

Table 1: TMEM74B Genotyping PCR Protocols

Assay TypeTargetForward PrimerReverse PrimerExpected Size (bp)
Standard PCRWildtypeTmem74b_111809_F: AAAATCCACGCAAATCCCAGTmem74b_111809_R: TCTCCACTGACCAAAACCCC581
Standard PCRMutantTmem74b_111809_F: AAAATCCACGCAAATCCCAGCAS_R1_Term: TCGTGGTATCGTTATGCGCC267
Standard PCRCassetteLacZ_2_small_F: ATCACGACGCGCTGTATCLacZ_2_small_R: ACATCGGGCAAATAATATCG108

The reaction setup should include DNA (50-100 ng), 10x Buffer, MgCl₂ (50 mM), Platinum Taq, dNTPs, primers, and ddH₂O. Thermal cycling conditions: 94°C for 5 min, followed by 35 cycles of 94°C for 30 sec, 58°C for 30 sec, and 72°C for 45 sec, with a final extension at 72°C for 5 min .

How should researchers validate recombinant TMEM74B expression in experimental systems?

Validation of recombinant TMEM74B expression requires a multi-pronged approach:

  • Western blotting: Using validated anti-TMEM74B antibodies for protein confirmation

  • qRT-PCR: Designing primers spanning exon-exon junctions to verify mRNA expression

  • Immunofluorescence microscopy: To confirm appropriate subcellular localization

  • Functional assays: Based on hypothesized functions (e.g., autophagy assays)

For each validation step, appropriate positive and negative controls should be included. When antibodies have limited validation, epitope-tagged versions of TMEM74B can provide an alternative detection strategy.

What experimental approaches are effective for studying TMEM74B protein interactions?

To study TMEM74B protein interactions, consider these methodological approaches:

  • Co-immunoprecipitation (Co-IP): Particularly useful for identifying stable protein-protein interactions

  • Proximity ligation assays: For detecting interactions in situ within cells

  • Yeast two-hybrid screening: For unbiased identification of potential binding partners

  • FRET/BRET analyses: For studying dynamic interactions in living cells

  • Mass spectrometry following IP: For comprehensive interactome profiling

Drawing from studies of TMEM74, which interacts with ATG16L1 and ATG9A, these autophagy-related proteins would be logical initial candidates to test for TMEM74B interactions .

How can researchers effectively analyze alternative splicing of TMEM74B?

Alternative splicing analysis of TMEM74B can be conducted using exon-level transcriptomic approaches. Based on successful applications in related research, the following methodology is recommended:

  • RNA extraction: High-quality RNA isolation from relevant tissues

  • Platform selection: Utilize exon-sensitive platforms (e.g., Affymetrix GeneChip Mouse Exon 1.0 ST arrays)

  • Bioinformatic analysis: Apply specialized algorithms for detection of alternatively spliced exons

  • Validation: Confirm findings using RT-PCR with exon-junction spanning primers

This approach has successfully identified alternatively spliced genes in other contexts, including studies of genes linked to seizure-induced cell death susceptibility .

What strategies can address contradictory findings in TMEM74B functional studies?

When facing contradictory findings in TMEM74B research, a systematic approach includes:

  • Cell type considerations: Test multiple cell lines to determine if effects are cell-type specific

  • Expression level analysis: Quantify expression levels across experimental systems, as function may be concentration-dependent

  • Conditional knockout models: Develop tissue-specific or inducible knockouts to clarify contextual functions

  • Isoform-specific investigation: Design experiments to distinguish between potential splice variants

  • Interactome mapping: Characterize different interaction partners across experimental systems

Additionally, consider that TMEM74-related autophagy operates through a distinct mechanism independent of BECN1/PI3KC3 complex and ULK1 , suggesting that TMEM74B might similarly function through non-canonical pathways.

How does TMEM74B contribute to cellular homeostasis under stress conditions?

Based on knowledge of TMEM74, which promotes tumor cell survival particularly under metabolic stress , a comprehensive experimental approach to study TMEM74B's role in stress response should include:

  • Stress condition panel: Test multiple stressors (nutrient deprivation, hypoxia, oxidative stress)

  • Cell viability assays: MTT, ATP content, and live/dead cell discrimination

  • Autophagy flux measurements: LC3-II conversion, p62 degradation, and tandem fluorescent LC3 reporters

  • Metabolic analysis: Seahorse analysis for mitochondrial function and glycolytic capacity

  • Signal pathway analysis: Investigation of AMPK, mTOR, and other stress-responsive pathways

This systematic approach allows for detailed characterization of how TMEM74B might influence cellular adaptation to various stress conditions.

How might CRISPR/Cas9 approaches advance TMEM74B research?

CRISPR/Cas9 technology offers several advantages for TMEM74B research:

  • Precise gene editing: Creation of specific mutations or domain deletions to identify functional regions

  • Endogenous tagging: Insertion of fluorescent or affinity tags at the native locus to study physiological expression

  • CRISPRi/CRISPRa approaches: For reversible modulation of expression without permanent genetic changes

  • CRISPR screening: For unbiased identification of genetic interactions

When designing CRISPR/Cas9 experiments for TMEM74B, researchers should consider potential off-target effects and validate edits through sequencing and functional assays.

What QTL mapping approaches are most effective for studying TMEM74B genetic associations?

For studying genetic associations of TMEM74B, researchers can employ QTL mapping approaches similar to those used in related studies:

  • Interval-specific congenic lines (ISCLs): Development of mouse lines with specific chromosomal segments containing the TMEM74B locus

  • Exon transcript abundance analysis: Comparing expression patterns between congenic lines and controls

  • Integrative genomic strategies: Combining genetic mapping with transcriptomic analysis

  • Alternative splicing analysis: Identifying strain-dependent differences in exon usage

This approach has successfully identified candidate genes for traits like seizure-induced cell death susceptibility and could be adapted for studies involving TMEM74B.

How can single-cell approaches enhance our understanding of TMEM74B biology?

Single-cell technologies offer unique insights into TMEM74B biology:

  • scRNA-seq: For identifying cell populations with distinctive TMEM74B expression patterns

  • scATAC-seq: For understanding the chromatin accessibility landscape regulating TMEM74B

  • Spatial transcriptomics: For mapping TMEM74B expression within tissue architecture

  • Live-cell imaging: For tracking dynamic TMEM74B-related processes at the single-cell level

These approaches can reveal heterogeneity in TMEM74B expression and function that might be masked in bulk analysis, potentially uncovering specialized roles in specific cellular contexts or developmental stages.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.