Recombinant Human Transmembrane protein 74 (TMEM74)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Human Transmembrane Protein 74 (TMEM74)

Transmembrane protein 74 (TMEM74) is a protein-coding gene in humans . TMEM74 is associated with diseases including Fuchs' endothelial dystrophy and corneal dystrophy . It contains two transmembrane domains, specifically amino acid residues 176–198 and 232–252 .

TMEM74 and Autophagy

TMEM74 can induce autophagy, a process where intracellular degradation occurs in lysosomes or vacuoles . TMEM74 increases the autophagic flux process in tumor cell lines, and interacts with ATG16L1 and ATG9A . TMEM74-related autophagy operates independently of the BECN1/PI3KC3 complex and ULK1 . TMEM74 may directly initiate and promote autophagy through interactions with ATG16L1 and ATG9A, which are responsible for nucleation and elongation, respectively . TMEM74-triggered autophagy has a pro-survival effect on tumor cells, especially those under metabolic stress . TMEM74 itself can be downregulated through the autophagic process, suggesting a self-regulatory loop to maintain appropriate autophagy levels and prevent excessive autophagy that could lead to cell death .

Experiments have shown that knockdown of TMEM74 can hinder autophagy, and that TMEM74 is located in the endoplasmic reticulum (ER) and incrementally associates with the mitochondria in a time-dependent manner, implying that TMEM74 translocation may occur during autophagy . TMEM74-triggered autophagy relies on the formation of the ATG5-ATG12/ATG16 and LC3B/PE complexes .

Role in Tumor Cell Survival

Research indicates that TMEM74 promotes tumor cell survival by inducing autophagy . High expression of TMEM74 significantly shortens the survival periods of patients in specific cancers . This suggests TMEM74 could be an effective therapeutic target to prolong the survival periods of cancer patients . TMEM74 increases the percentage of surviving cells and fewer TMEM74-overexpressing cells undergo cell death in response to metabolic stress .

Clinical Significance

Clinical database analysis indicates that high expression of TMEM74 significantly shortens the surviving periods of patients in several specific cancers . This suggests that TMEM74 has clinical value and can be treated as an effective potential target to prolong the survival periods of cancer patients in the future .

TMEM74 as an Oncogene

TMEM74 may act as an oncogene and a potential diagnostic marker and therapeutic target for liver cancer and lung cancer .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TMEM74; Transmembrane protein 74
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-305
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMEM74
Target Protein Sequence
MELHYLAKKSNQADLCDARDWSSRGLPGDQADTAATRAALCCQKQCASTPRATEMEGSKL SSSPASPSSSLQNSTLQPDAFPPGLLHSGNNQITAERKVCNCCSQELETSFTYVDKNINL EQRNRSSPSAKGHNHPGELGWENPNEWSQEAAISLISEEEDDTSSEATSSGKSIDYGFIS AILFLVTGILLVIISYIVPREVTVDPNTVAAREMERLEKESARLGAHLDRCVIAGLCLLT LGGVILSCLLMMSMWKGELYRRNRFASSKESAKLYGSFNFRMKTSTNENTLELSLVEEDA LAVQS
Uniprot No.

Target Background

Function
TMEM74 plays a crucial role in autophagy, a process potentially involving PI3K signal transduction.
Gene References Into Functions
  1. Research indicates that the autophagy modulator TMEM74 interacts with the apoptosis inducer BIK, inhibiting its function. PMID: 28412412
  2. Studies show that TMEM74 may promote functional autophagy under cellular stress conditions such as starvation. PMID: 18294959
Database Links

HGNC: 26409

OMIM: 613935

KEGG: hsa:157753

STRING: 9606.ENSP00000297459

UniGene: Hs.99439

Protein Families
TMEM74 family
Subcellular Location
Lysosome membrane; Multi-pass membrane protein. Cytoplasmic vesicle, autophagosome membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in heart, lung, and placenta.

Q&A

What is Transmembrane Protein 74 (TMEM74)?

TMEM74 is a transmembrane protein that functions as a positive modulator of autophagy through a unique pathway distinct from canonical autophagy mechanisms. It contains two putative transmembrane (TM) domains located at amino acid residues 176-198 and 232-252, which are critical for its function. TMEM74 has been shown to increase autophagic flux in multiple tumor cell lines and promotes tumor cell survival, particularly under metabolic stress conditions.

How does TMEM74 differ from other autophagy regulators?

Unlike common autophagy regulators, TMEM74 operates independently of the BECN1/PI3KC3 complex and ULK1, which are typically considered essential for canonical autophagy initiation. TMEM74 appears to initiate and promote autophagy directly through interactions with ATG16L1 and ATG9A, which are responsible for nucleation and elongation of the autophagosomal membrane, respectively. This bypass of upstream signaling pathways positions TMEM74 as a unique autophagy initiator and promoter.

What are the key structural features of TMEM74?

TMEM74 contains two critical transmembrane domains that span amino acid residues 176-198 and 232-252. Research has demonstrated that these TM domains are essential for TMEM74's function, as truncated mutants lacking these domains (TMEM74Δ) fail to induce autophagy, shown by decreased LC3B-II levels and sparse LC3 puncta distribution. Additionally, the truncated TMEM74 does not display the characteristic punctate localization pattern of functional TMEM74.

What is the subcellular localization of TMEM74?

Live cell imaging studies of HeLa cells expressing GFP-TMEM74 and various organelle markers have revealed that TMEM74 localizes primarily to the endoplasmic reticulum (ER). Interestingly, TMEM74 also exhibits a time-dependent association with mitochondria, suggesting potential translocation dynamics during the autophagic process. This dynamic localization pattern may be significant for TMEM74's role in coordinating the membrane sources for autophagosome formation.

What is the mechanism by which TMEM74 induces autophagy?

TMEM74 induces autophagy through direct interactions with key autophagy proteins, specifically ATG16L1 and ATG9A. When TMEM74 anchors to source membranes, it recruits ATG16L1, promoting the formation of the ATG5-ATG12/ATG16L1 complex via ATG7 and ATG10. Subsequently, ATG3-LC3 intermediates activated by ATG7 are recruited to the membranes through the interaction between ATG3 and ATG12, bringing LC3 in proximity to phosphatidylethanolamine (PE) in the membranes, leading to LC3 lipidation. Additionally, TMEM74's interaction with ATG9A may facilitate vesicle tethering to phagophores, supporting their expansion.

How can researchers measure TMEM74-induced autophagic flux?

Researchers can assess TMEM74-induced autophagic flux through multiple complementary methods:

  • Western blot analysis of LC3B-II levels with and without bafilomycin A1 treatment

  • Quantification of GFP/RFP-LC3B puncta distribution using confocal microscopy

  • Colocalization analysis of GFP-LC3B puncta with mCherry-LAMP1 to assess autophagolysosome formation

  • Measurement of free GFP levels (cleaved from GFP-LC3) as an indicator of lysosomal degradation

  • Analysis of SQSTM1/p62 degradation, which correlates with autophagic activity

Collectively, these methods provide a comprehensive assessment of TMEM74's impact on the complete autophagic process.

What cell models are optimal for studying TMEM74 function?

Based on published research, several cell lines have been successfully used to investigate TMEM74 function:

  • HeLa cells - Extensively used for both overexpression and knockdown studies of TMEM74

  • HepG2 cells - Liver cancer cells showing robust TMEM74-induced autophagy

  • 786-O cells - Renal cancer cells demonstrating clear autophagic responses to TMEM74 modulation

  • U2OS cells - Osteosarcoma cells used for survival studies related to TMEM74 expression

For knockdown experiments, siRNA approaches have been effective in all these cell lines, with particular success in studying EBSS-induced autophagy in the context of TMEM74 depletion.

How can researchers effectively modulate TMEM74 expression in experimental systems?

Researchers can modulate TMEM74 expression through several approaches:

  • Overexpression systems: Transfection with GFP-TMEM74 or other tagged TMEM74 constructs allows visualization and functional analysis.

  • Knockdown approaches: siRNA targeting TMEM74 has been successfully used to reduce endogenous expression.

  • Mutant constructs: Truncated versions such as TMEM74Δ (lacking TM domains) can serve as non-functional controls.

  • Fluorescent fusion proteins: GFP-TMEM74 constructs facilitate live-cell imaging of TMEM74 localization and dynamics.

When designing these experiments, it's important to include appropriate controls and to verify expression levels through both protein (Western blot) and localization (immunofluorescence) analyses.

How does TMEM74-induced autophagy affect tumor cell survival?

TMEM74-triggered autophagy promotes tumor cell survival, particularly under metabolic stress conditions. Flow cytometry and CCK-8 (cell counting kit-8) assays have demonstrated that TMEM74 overexpression increases the percentage of surviving cells in multiple tumor cell lines, including HeLa, HepG2, U2OS, and 786-O cells. This survival advantage is especially pronounced when cells are subjected to glucose starvation or treatment with anti-cancer drugs like etoposide.

The survival-promoting effect of TMEM74 is autophagy-dependent, as treatment with autophagy inhibitors like bafilomycin A1 reduces the survival advantage conferred by TMEM74 overexpression. Conversely, knockdown of TMEM74 decreases cell viability, particularly under starvation conditions, indicating that TMEM74-mediated autophagy provides resistance to metabolic stress.

What is the relationship between TMEM74 expression and cancer patient outcomes?

Cancer TypeTMEM74 Expression ImpactPatient SubgroupEffect on Survival
Breast CancerHigh expressionBasal-like 1 Pietenpol subtypeReduced relapse-free survival
Breast CancerHigh expressionGrade 1 and 2Reduced survival
Gastric CancerHigh expressionDiffuse typeReduced first progression survival
Gastric CancerHigh expressionIntestinal and mixed typesReduced first progression survival
Gastric CancerHigh expressionStage 3Reduced first progression survival

Clinical database analysis has revealed that high TMEM74 expression significantly correlates with shorter survival periods in several cancer types and subtypes. This suggests that TMEM74 could serve as a potential prognostic marker and therapeutic target in specific cancers.

How is TMEM74 itself regulated through autophagy?

Intriguingly, TMEM74 exhibits a self-regulatory mechanism whereby it can be downregulated through the very autophagic process it induces. This creates a potential negative feedback loop that may function to maintain appropriate levels of autophagy in cells. This self-regulation mechanism appears to prevent excessive autophagy that might otherwise lead to cell death. The precise molecular mechanisms governing this self-regulatory loop remain an active area of investigation and represent an important direction for future research.

What is the role of TMEM74 in ATG9A trafficking and membrane dynamics?

TMEM74 interaction with ATG9A may play a critical role in membrane trafficking during autophagosome formation. ATG9A recycling between the phagophore assembly site (PAS) and peripheral structures is essential for transporting membrane materials to growing autophagosomes. Based on current research, the interactions between TMEM74 and ATG9A may be required for anterograde transport, while TMEM74-mediated interaction between ATG9A and WIPI1 (the homolog of yeast Atg18) may contribute to retrograde transport. These dynamics position TMEM74 as a potential coordinator of membrane flow during autophagosome biogenesis.

How might engineered TMEM74 variants advance therapeutic applications?

Recent advances in de novo design of transmembrane domains offer intriguing possibilities for engineered TMEM74 variants. Researchers have developed programmed membrane proteins (proMPs) with single-pass α-helical TMDs that self-assemble through computationally defined interfaces. This approach could potentially be applied to create TMEM74 variants with altered oligomerization properties, subcellular targeting, or interaction partners.

Given TMEM74's role in cancer cell survival and its correlation with poor patient outcomes, engineered variants could serve as dominant-negative inhibitors of endogenous TMEM74 function or as experimental tools to further dissect the protein's mechanistic contributions to autophagy and cell survival. These applications might leverage the relationship observed between oligomeric state and signaling capacity seen in other transmembrane systems.

What autophagy assays are most informative for studying TMEM74 function?

When investigating TMEM74, researchers should employ multiple complementary autophagy assays:

  • LC3 conversion assays: Western blot analysis of LC3-I to LC3-II conversion, with and without lysosomal inhibitors like bafilomycin A1.

  • Fluorescent puncta analysis: Quantification of GFP-LC3 or RFP-LC3 puncta formation using confocal microscopy.

  • Autophagic flux assays: Using tandem fluorescent-tagged LC3 (mRFP-GFP-LC3) to distinguish autophagosomes from autolysosomes.

  • Colocalization studies: Analysis of TMEM74 colocalization with autophagy-related proteins (ATG16L1, ATG9A) and organelle markers.

  • Protein degradation assays: Monitoring the degradation of autophagic substrates like SQSTM1/p62.

  • Ultrastructural analysis: Electron microscopy to visualize autophagosome formation and morphology.

What protein-protein interaction methods are effective for studying TMEM74's binding partners?

To characterize TMEM74's interactions with autophagy proteins, several approaches have proven effective:

  • Co-immunoprecipitation (Co-IP): For detecting native protein complexes containing TMEM74.

  • GST pull-down assays: Using recombinant GST-tagged TMEM74 to identify direct binding partners.

  • Proximity labeling methods: BioID or APEX2-based approaches to identify proteins in close proximity to TMEM74 in living cells.

  • Fluorescence resonance energy transfer (FRET): For studying interactions between TMEM74 and binding partners in living cells.

  • Yeast two-hybrid screening: To identify novel TMEM74-interacting proteins.

These methods have helped establish TMEM74's interactions with key autophagy proteins like ATG16L1 and ATG9A, which are central to its mechanism of action.

What are the emerging questions about TMEM74's role beyond autophagy?

While TMEM74's role in autophagy is well-established, several emerging questions deserve investigation:

  • Does TMEM74 influence other membrane trafficking pathways beyond autophagy?

  • What is TMEM74's evolutionary history, and how conserved is its function across species?

  • Does TMEM74 have autophagy-independent functions in cellular homeostasis?

  • How is TMEM74 expression regulated at the transcriptional and post-translational levels?

  • Are there tissue-specific roles for TMEM74 beyond its documented functions in cancer cells?

These questions represent promising avenues for expanding our understanding of TMEM74 biology.

How might research on TMEM74 contribute to the development of cancer therapeutics?

Given TMEM74's role in promoting tumor cell survival and its correlation with poor clinical outcomes, it represents a promising target for cancer therapeutics. Several approaches merit investigation:

  • Small molecule inhibitors: Compounds targeting TMEM74-ATG16L1 or TMEM74-ATG9A interactions.

  • Peptide-based inhibitors: Designed to disrupt specific protein-protein interactions involving TMEM74.

  • Gene therapy approaches: siRNA or CRISPR-based targeting of TMEM74 in cancer cells.

  • Biomarker development: Using TMEM74 expression levels for patient stratification and treatment selection.

  • Combination therapies: Targeting TMEM74-mediated autophagy alongside conventional chemotherapies to overcome treatment resistance.

The clinical database analyses showing reduced survival in patients with high TMEM74 expression provide a strong rationale for these therapeutic directions.

What are the challenges in producing recombinant TMEM74 for structural studies?

Producing recombinant transmembrane proteins like TMEM74 presents several challenges:

  • Membrane protein solubility: TMEM74 contains two transmembrane domains that make it inherently hydrophobic and difficult to solubilize while maintaining native structure.

  • Expression systems: Bacterial systems often fail to properly fold mammalian membrane proteins, necessitating eukaryotic expression systems like insect cells or mammalian cells.

  • Purification strategies: Detergent selection is critical for extracting TMEM74 from membranes while preserving its structural integrity and function.

  • Protein stability: Maintaining TMEM74 stability during purification and subsequent studies requires careful buffer optimization.

  • Functional verification: Ensuring that recombinant TMEM74 retains its native activity is essential for meaningful structural studies.

Emerging approaches like nanodiscs or amphipols may help overcome some of these challenges by providing membrane-mimetic environments.

What expression systems are optimal for recombinant TMEM74 production?

Based on experiences with similar transmembrane proteins, several expression systems merit consideration for TMEM74 production:

  • Mammalian expression systems: HEK293 or CHO cells may provide the most native environment for proper folding and post-translational modifications of human TMEM74.

  • Insect cell systems: Baculovirus-infected Sf9 or Hi5 cells offer high expression levels while maintaining eukaryotic folding machinery.

  • Yeast systems: Pichia pastoris or Saccharomyces cerevisiae may balance yield and proper folding.

  • Cell-free systems: Supplemented with appropriate membrane mimetics, these can produce TMEM74 directly into a solubilized state.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.