Recombinant Human Transmembrane protein 75 (TMEM75)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of Recombinant TMEM75

Recombinant TMEM75 is expressed in E. coli with an N-terminal His tag for purification and detection purposes. Key structural and production details include:

PropertyDetail
UniProt IDQ8N9X5
Amino Acid SequenceFull-length (1-138 aa)
Molecular Weight~16 kDa
TagHis tag
Expression SystemEscherichia coli
Purity>85% (as determined by SDS-PAGE)
ApplicationsAntibody production, protein interaction studies, enzymatic assays

This recombinant form retains the protein's transmembrane domains, critical for studying its interaction with lipid bilayers and cellular membranes.

Functional Associations of TMEM75

TMEM75 exhibits diverse biological associations across multiple datasets, as shown below:

Key Functional Links

CategoryAssociationDataset Source
Gene ExpressionOverexpressed in specific brain tissues and pancreatic cell linesAllen Brain Atlas, CCLE Expression Profiles
Transcription RegulationLinked to transcription factors (e.g., STAT3, NF-κB)CHEA Transcription Factor Targets
Disease PerturbationsDifferential expression in lung adenocarcinoma and ovarian cancerGEO Disease Signatures
Copy Number VariationsAmplified in 2% of cancer cell lines (e.g., COLO-720E colorectal line)COSMIC CNV Profiles

Comparative Context with TMEM Family

Though TMEM75-specific studies are sparse, parallels exist with related TMEM proteins:

TMEM ProteinCancer RoleMechanism
TMEM45AOncogenic in glioblastoma, ovarian cancerPromotes proliferation via TGF-β/NF-κB
TMEM119Drives metastasis in osteosarcomaActivates TGF-β/BMP pathways
TMEM170BTumor suppressor in breast cancerInhibits Wnt/β-catenin signaling

Like these relatives, TMEM75 may regulate growth or survival pathways in a context-dependent manner, though further validation is needed.

Availability and Applications

The recombinant TMEM75 protein (Cat. No. RFL18627HF) is commercially available for in vitro studies. Its primary uses include:

  • Investigating transmembrane protein dynamics

  • Screening for protein-protein interaction inhibitors

  • Developing antibodies for diagnostic assays

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment based on your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
LINC02912; TMEM75; Putative protein encoded by LINC02912
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-138
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMEM75
Target Protein Sequence
MRPTADSFRLKKGNVFPNFDPCAQALQKSCHFALSFLIGKMGIIILSVCLICTRLLQEGI AQSKCLINVSFSLYSCFIVFVTISQDSETLSLDCDHRLFFSLPFTDPASGGQSQHSWPCP ERSKNLPQVSKQLRNRAG
Uniprot No.

Target Background

Database Links

HGNC: 32295

STRING: 9606.ENSP00000446264

UniGene: Hs.629674

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of human TMEM75?

TMEM75 is a transmembrane protein encoded in chromosome region 8q24.21, an area frequently amplified in various cancer types. As a transmembrane protein, it contains multiple membrane-spanning domains that facilitate its integration into cellular membranes. Unlike the well-characterized TMEM175 (which has two six-transmembrane domains that function as a dimer), the specific structural architecture of TMEM75 requires further elucidation through crystallography or cryo-electron microscopy techniques . Current structural prediction methods suggest multiple transmembrane helices that likely contribute to its functional properties in cellular signaling and membrane organization.

What cellular compartments express TMEM75?

TMEM75 expression has been detected primarily in epithelial tissues with notable upregulation in colorectal cancer tissues compared to adjacent normal tissues . While the precise subcellular localization remains under investigation, preliminary evidence suggests membrane association with potential involvement in oncogenic signaling pathways. Researchers studying TMEM75 should employ subcellular fractionation followed by Western blotting or immunofluorescence microscopy with compartment-specific markers to precisely determine its distribution across cellular organelles.

How does TMEM75 differ from other TMEM family proteins?

While TMEM75 belongs to the broader transmembrane protein family, it exhibits distinct functional characteristics from other members such as TMEM175. Unlike TMEM175, which functions as a lysosomal potassium and proton channel with well-characterized roles in pH regulation and membrane potential maintenance , TMEM75 appears to be involved in transcriptional regulation through interaction with factors like SIM2 . This functional divergence highlights the specialization within the TMEM protein family, with each member contributing uniquely to cellular physiology.

What evidence supports TMEM75's role in cancer development?

Multiple lines of evidence implicate TMEM75 in cancer pathogenesis. In breast cancer, TMEM75 amplification has been identified as part of the oncogenic alterations in the 8q24.21 chromosomal region . Similarly, in colorectal cancer, TMEM75 expression positively correlates with advanced clinical stage, suggesting its involvement in disease progression . Functional studies have demonstrated that TMEM75 silencing delays tumor growth in vivo, providing direct evidence for its pro-oncogenic activity. The amplification of this gene in multiple cancer types suggests a conserved mechanism contributing to tumorigenesis across different tissues.

What molecular mechanisms underlie TMEM75's oncogenic activity?

TMEM75 appears to exert its oncogenic effects through activation of the transcription factor SIM2 . Research has shown that TMEM75 can activate SIM2 expression, and experimental evidence demonstrates that ectopic expression of SIM2 rescues the inhibitory effects of TMEM75 depletion on cancer cell proliferation, migration, and invasion. This transcriptional regulatory mechanism represents a potential therapeutic vulnerability, as disruption of the TMEM75-SIM2 axis could impair oncogenic signaling in multiple cancer types.

What are the optimal techniques for detecting TMEM75 expression in tissue samples?

For reliable detection of TMEM75 in tissue samples, researchers should employ a multi-modal approach:

  • RNA-level detection: Quantitative real-time PCR (qRT-PCR) using validated TMEM75-specific primers provides sensitive detection of transcript levels. RNA-seq analysis can offer broader context about associated gene networks.

  • Protein-level detection: Immunohistochemistry (IHC) with validated anti-TMEM75 antibodies enables visualization of protein expression and localization within tissue architecture. Western blotting provides quantitative assessment of protein levels.

  • In situ hybridization: RNAscope or similar technologies can localize TMEM75 mRNA with cellular resolution while maintaining tissue context.

For comprehensive analysis, researchers should compare expression between tumor and adjacent normal tissues, correlating findings with clinicopathological features to establish clinical relevance.

How can TMEM75 function be modulated in experimental models?

To investigate TMEM75 function, researchers can employ several complementary approaches:

  • Gene silencing: siRNA or shRNA targeting TMEM75 can achieve transient or stable knockdown, respectively. CRISPR-Cas9 gene editing provides more complete genetic knockout.

  • Overexpression systems: Transfection with TMEM75 expression vectors containing epitope tags facilitates detection and purification in experimental systems.

  • Inducible expression systems: Tetracycline-regulated expression systems allow temporal control of TMEM75 expression to study acute versus chronic effects.

  • Domain-specific mutations: Site-directed mutagenesis of predicted functional domains can identify critical regions for protein activity.

In colorectal cancer models, TMEM75 silencing has successfully delayed tumor growth in vivo, validating the efficacy of genetic modulation approaches .

What cell lines are most appropriate for TMEM75 research?

Based on current literature, researchers investigating TMEM75 should consider:

  • Colorectal cancer lines: HCT116, SW480, and DLD-1 have demonstrated detectable TMEM75 expression and functional responses to its modulation .

  • Esophageal cancer lines: KYSE series cell lines reflect the significance of TMEM75 in esophageal cancer risk stratification .

  • Breast cancer lines: MCF-7 and MDA-MB-231 represent models where 8q24.21 amplifications containing TMEM75 have been documented .

For all experimental systems, researchers should verify baseline TMEM75 expression levels and consider the genetic background, particularly regarding pathways potentially relevant to TMEM75 function, such as SIM2 signaling.

How do post-translational modifications affect TMEM75 function?

While direct evidence of TMEM75 post-translational modifications remains limited, transmembrane proteins typically undergo various modifications that influence their folding, localization, and function. Researchers should investigate:

  • Phosphorylation sites: Prediction algorithms can identify potential phosphorylation sites that may regulate TMEM75 activity. Mass spectrometry following immunoprecipitation can confirm these predictions.

  • Glycosylation patterns: N-linked and O-linked glycosylation often affect membrane protein trafficking and stability. Treatment with glycosidases followed by mobility shift analysis can reveal glycosylation status.

  • Ubiquitination: This modification typically regulates protein turnover. Proteasome inhibitors combined with ubiquitin immunoprecipitation can assess TMEM75 ubiquitination.

Understanding these modifications could reveal regulatory mechanisms and potential therapeutic intervention points in cancer contexts where TMEM75 is overexpressed.

What is the relationship between TMEM75 expression and response to cancer therapies?

The correlation between TMEM75 expression and treatment outcomes represents a critical research frontier. Investigators should:

  • Analyze clinical cohorts: Correlate TMEM75 expression levels with response rates to standard chemotherapy, targeted therapies, and immunotherapies across cancer types.

  • Perform drug sensitivity testing: Compare drug response profiles between TMEM75-high and TMEM75-low cancer cell lines to identify differential sensitivities.

  • Investigate combination approaches: Test whether TMEM75 inhibition synergizes with established therapies, particularly those targeting pathways connected to SIM2 signaling.

Given that higher TMEM75 expression correlates with poorer prognosis in several cancer types, determining whether it contributes to therapy resistance could identify patients who might benefit from alternative treatment strategies.

What is the evolutionary conservation of TMEM75 across species?

Understanding the evolutionary history of TMEM75 could provide insights into its fundamental biological functions. Researchers should:

  • Conduct phylogenetic analysis: Compare TMEM75 sequences across vertebrates to identify conserved domains likely crucial for function.

  • Examine syntenic regions: Analyze gene organization around TMEM75 across species to understand evolutionary pressure on this genomic region.

  • Assess functional conservation: Test whether TMEM75 orthologs from different species can rescue phenotypes in human cell models lacking TMEM75.

Unlike TMEM175, which shows conservation across bacteria, archaea, and animals , the evolutionary distribution of TMEM75 requires further characterization to understand its biological significance beyond its pathological roles in cancer.

How should researchers design experiments to study TMEM75 interactions with SIM2?

To elucidate the TMEM75-SIM2 regulatory axis, researchers should employ a systematic approach:

  • Co-immunoprecipitation: Using epitope-tagged versions of both proteins to confirm physical interaction. Both forward and reverse immunoprecipitation should be performed.

  • Proximity ligation assay: To visualize protein-protein interactions in situ with subcellular resolution.

  • Chromatin immunoprecipitation: To identify genomic regions bound by SIM2 that are affected by TMEM75 modulation.

  • Luciferase reporter assays: Using SIM2-responsive promoter constructs to quantify the functional impact of TMEM75 on SIM2 transcriptional activity.

  • Domain mapping: Creating truncation and point mutation variants to identify specific interaction regions within both proteins.

This comprehensive approach would establish both the physical and functional relationship between TMEM75 and SIM2, potentially revealing druggable interfaces.

What considerations are important when developing TMEM75-targeted therapeutics?

Researchers pursuing TMEM75 as a therapeutic target should address several critical aspects:

  • Target validation: Confirm the requirement for TMEM75 in maintaining cancer phenotypes across multiple models using genetic approaches before investing in therapeutic development.

  • Specificity assessment: Ensure that targeting approaches distinguish TMEM75 from other TMEM family members to avoid off-target effects.

  • Therapeutic modalities: Consider multiple approaches including:

    • Small molecule inhibitors targeting protein-protein interactions

    • Monoclonal antibodies against extracellular domains (if present)

    • Antisense oligonucleotides or siRNA-based approaches for expression inhibition

  • Biomarker development: Establish reliable methods to quantify TMEM75 in clinical samples to identify patients most likely to benefit from TMEM75-targeted therapies.

The therapeutic development should be guided by the understanding that TMEM75 appears to function through transcriptional regulation rather than as an ion channel like other TMEM family members .

How can multi-omics approaches enhance our understanding of TMEM75 in cancer?

Integrative multi-omics strategies can provide comprehensive insights into TMEM75 biology:

  • Genomics: Analyze copy number variations and mutations affecting TMEM75 across cancer types. In breast cancer, TMEM75 amplification occurs in the 8q24.21 chromosomal region .

  • Transcriptomics: RNA-seq analysis following TMEM75 modulation can identify downstream effector pathways. Compare gene expression changes with SIM2 overexpression to identify overlapping signatures.

  • Proteomics: Mass spectrometry-based interactome analysis can identify protein complexes containing TMEM75, providing insights into its cellular functions.

  • Metabolomics: Measure metabolic changes following TMEM75 modulation to understand its impact on cancer metabolism.

  • Single-cell analysis: Characterize heterogeneity of TMEM75 expression within tumors and correlate with cell states and microenvironmental features.

Integration of these approaches could reveal unexpected functions and place TMEM75 within the broader context of cancer signaling networks, potentially identifying synthetic lethal interactions that could be therapeutically exploited.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.