Recombinant Human Transmembrane protein 78 (TMEM78)

Shipped with Ice Packs
In Stock

Description

Structure and Function

TMEM78 is a transmembrane protein, meaning it spans the cell membrane . Transmembrane proteins like TMEM78 are involved in cell signaling, transport, and maintaining cell structure . TMEM78 has been reported to regulate changes in downstream effectors by mediating different signaling pathways and has been confirmed to be widely involved in cell proliferation, differentiation, apoptosis, and tumor progression .

Role in Malignant Tumors

TMEM78 has been identified as a potential therapeutic target in treating malignant tumors . Malignant tumors are predicted to continue to be a threat because their influencing factors, pathogenesis, and progression characteristics have not been fully clarified . Studies have explored the role of TMEM78 in several types of cancer, including:

Involvement in Signaling Pathways

TMEM78 interacts with the Wnt/β-catenin signaling pathway, which regulates embryonic development, tissue homeostasis, and cancer development . TMEM88 can bind to the PDZ domain of the scrambled protein and prohibit the Wnt/β-catenin signaling pathway, which exerts a nonnegligible effect in regulating tumor cell proliferation, metastasis and host antitumor immunity . TMEM88 can function by regulating different downstream oncogenic signals and effector molecules and transmit upstream signals to interfere with the occurrence and progression of tumors and then have an anticancer effect .

Research and Clinical Significance

Research AreaFindings
Gene Expression AnalysisTMEM88 expression is closely correlated with the mRNA expression levels of c-Myc and β-catenin mRNA .
Protein InteractionsTMEM88 interacts with DVL proteins to regulate the Wnt/β-catenin signaling pathways .
Functional StudiesOverexpression of TMEM88 can inhibit the excessive proliferation, invasion, and migration of cancer cells, preventing the growth of transplanted tumors .
Clinical ImplicationsTargeting TMEM88 may offer new therapeutic strategies for treating various cancers . Further research is needed to fully elucidate the mechanisms of TMEM78 and its potential as a therapeutic target .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment based on your requirements.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If a particular tag is required, please specify this in advance, and we will prioritize its use in the manufacturing process.
Synonyms
TMEM78; Transmembrane protein 78
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-136
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMEM78
Target Protein Sequence
MWLDTRNLGIVISCWKGVCVPQTTTLEMFYNDNDRVEESSNSYQIRREFLLPACLPAFLS FSTSFSFFLSFLPLSLSLFLPFFPSFFLSLSLSPSFLPSFLRQGLALSPRLECDGAIMIH CSLNIPGSSDPPTSAS
Uniprot No.

Target Background

Database Links

HGNC: 32307

UniGene: Hs.638407

Subcellular Location
Membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.