Recombinant Human Transmembrane protein 80 (TMEM80)

Shipped with Ice Packs
In Stock

Description

Key Features:

  • Domains: Predicted transmembrane helices with cytoplasmic N- and C-termini .

  • Post-translational modifications: None reported to date, though glycosylation or phosphorylation sites are under investigation .

  • Interactions: Partners include TMEM231, B9D1, and CC2D2A, suggesting roles in ciliary function and signaling pathways .

Production and Recombinant Variants

Recombinant TMEM80 is produced using systems such as E. coli and mammalian cells (e.g., HEK293), often fused with tags (e.g., His, Fc) for purification or detection .

Available Recombinant Forms:

Catalog IDHost SystemSpeciesTag(s)Length (aa)Source
RFL5649HFE. coliHumanHis1–168Creative BioMart
TMEM80-9426MHEK293MouseHis/Fc/AviFull-lengthCreative BioMart
TMEM80-930HCLHEK293HumanNoneFull-lengthCreative BioMart

A. Cellular Roles

  • Ciliogenesis: TMEM80 interacts with tectonic-like complex proteins (e.g., TMEM231, B9D1) involved in primary cilia formation, suggesting a role in ciliary barrier function .

  • Signaling Pathways: Indirect associations with Wnt/β-catenin and TGF-β pathways, which are critical in cancer and development .

B. Disease Associations

While TMEM80’s direct role in cancer remains uncharacterized, transcriptomic studies highlight differential expression in cancers such as ovarian and colorectal malignancies . Its interaction partners (e.g., TMEM67) are linked to ciliopathies and developmental disorders .

A. Antibodies and Detection

Validated antibodies (e.g., GeneTex GTX83504, Invitrogen CF501399) enable TMEM80 detection in Western blotting, immunocytochemistry, and flow cytometry .

B. Interaction Networks

STRING database analysis identifies functional partners:

Partner ProteinFunctional RoleInteraction Score
TMEM231Ciliary barrier assembly0.758
B9D1Ciliogenesis and SHH signaling0.718
CC2D2ATransition zone organization0.523

Source: STRING interaction network analysis

Challenges and Future Directions

  • Functional Characterization: The physiological role of TMEM80 remains poorly understood, necessitating knockout studies or CRISPR-based screens .

  • Therapeutic Potential: Links to ciliary dysfunction and cancer warrant exploration in drug discovery pipelines .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please include them in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference point.
Shelf Life
The shelf life is influenced by several factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preference for a specific tag type, please inform us, and we will prioritize its development for your product.
Synonyms
TMEM80; Transmembrane protein 80
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-168
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMEM80
Target Protein Sequence
MAEGARARGPRGCRDRDGPAGGAGKMAAPRRGRGSSTVLSSVPLQMLFYLSGTYYALYFL ATLLMITYKSQVFSYPHRYLVLDLALLFLMGILEAVRLYLGTRGNLTEAERPLAASLALT AGTALLSAHFLLWQALVLWADWALSATLLALHGLEAVLQVVAIAAFTR
Uniprot No.

Target Background

Database Links

HGNC: 27453

KEGG: hsa:283232

STRING: 9606.ENSP00000380646

UniGene: Hs.448664

Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium.

Q&A

What is TMEM80 and what are its known functions?

TMEM80 (transmembrane protein 80) is a membrane-integrated protein that has been identified in various species including humans, mice, and rats. While the complete functional characterization remains an active area of investigation, studies indicate that TMEM80 may play roles in cellular signaling pathways and membrane organization. Research has shown that TMEM80 expression is affected by various chemical compounds, suggesting potential roles in cellular stress responses or metabolic pathways. Unlike Thioredoxin-80 (Trx80), which is a proteolytic cleavage product with cytokine activity, TMEM80 appears to function primarily as an integral membrane protein with distinct tissue expression patterns .

In which tissues and developmental stages is TMEM80 predominantly expressed?

TMEM80 demonstrates a diverse expression profile across multiple tissues and developmental stages. Based on studies in model organisms such as Xenopus, TMEM80 expression has been detected in the anterior dorsal lateral plate region, eggs, eye, head region, intestine, lateral plate mesoderm, pharyngeal arch, pronephric duct, pronephric kidney, pronephric nephrostome, and testis . The developmental expression ranges from unfertilized egg stage to NF stage 41 in Xenopus, suggesting potential roles in both early development and adult tissue function. This broad expression pattern indicates that TMEM80 may have tissue-specific functions that vary throughout developmental progression .

How is TMEM80 gene expression regulated?

TMEM80 expression appears to be significantly influenced by various chemical compounds. Research data indicates that certain chemicals can either increase or decrease TMEM80 expression. For instance, compounds such as 1,2-dichloroethane and 3,4-methylenedioxymethamphetamine have been shown to increase TMEM80 expression, while others like 2-hydroxypropanoic acid (lactic acid), 6-propyl-2-thiouracil, acrylamide, and aflatoxin B1 decrease expression . These findings suggest that TMEM80 expression is responsive to environmental factors and may be involved in cellular stress response pathways. The regulation likely involves transcription factors responding to specific cellular conditions, though the exact regulatory mechanisms require further elucidation .

What are the optimal expression systems for producing recombinant human TMEM80?

The optimal expression systems for producing recombinant human TMEM80 depend on the experimental requirements and downstream applications. For structural and functional studies requiring properly folded membrane proteins, mammalian expression systems such as HEK293 or CHO cells are recommended due to their ability to perform post-translational modifications and provide appropriate membrane environments. For higher yield production, insect cell expression systems (Sf9, High Five) offer a good compromise between proper folding and quantity. Though bacterial systems like E. coli might provide higher yields, they often struggle with proper folding of complex transmembrane proteins. When working with TMEM80, it's advisable to incorporate affinity tags (e.g., His6, FLAG) to facilitate purification while ensuring they don't interfere with protein function by placing them at termini predicted to be non-critical for function .

How can researchers effectively validate TMEM80 antibody specificity for experimental applications?

Validating TMEM80 antibody specificity is crucial for reliable experimental outcomes. A comprehensive validation approach should include multiple complementary methods. First, perform Western blot analysis comparing wild-type cells with TMEM80 knockdown/knockout controls to confirm the absence of bands in the knockout samples. Second, conduct immunofluorescence studies comparing staining patterns in cells with and without TMEM80 expression. Third, validate through immunoprecipitation followed by mass spectrometry to confirm that the antibody captures TMEM80 specifically. Fourth, use heterologous expression systems to express tagged versions of TMEM80 and confirm antibody recognition. Additionally, testing the antibody across multiple experimental conditions (different fixation methods, sample preparations) helps establish robust protocols. Finally, compare results from multiple antibodies targeting different epitopes of TMEM80 to ensure consistency in detection patterns .

What methods are recommended for studying TMEM80 protein-protein interactions?

For studying TMEM80 protein-protein interactions, a multi-method approach is recommended to overcome challenges associated with membrane proteins. Co-immunoprecipitation (Co-IP) can be effectively employed using mild detergents like digitonin or DDM that preserve protein-protein interactions while solubilizing membranes. Proximity-based labeling methods such as BioID or APEX2 are particularly valuable, as they allow identification of transient or weak interactions in the native cellular environment by tagging TMEM80 with a promiscuous biotin ligase. Förster Resonance Energy Transfer (FRET) or Bimolecular Fluorescence Complementation (BiFC) can provide spatial information about interactions in living cells. For higher-resolution structural insights, crosslinking mass spectrometry (XL-MS) coupled with computational modeling can map interaction interfaces. Finally, yeast two-hybrid membrane systems specially designed for membrane proteins or mammalian membrane two-hybrid assays might be applicable depending on TMEM80's topology .

How can Mendelian Randomization be applied to investigate TMEM80's causal role in disease pathways?

Mendelian Randomization (MR) represents a powerful approach for investigating TMEM80's potential causal role in disease pathways. Researchers should first identify genetic variants (single nucleotide polymorphisms, SNPs) that act as instrumental variables (IVs) strongly associated with TMEM80 expression through expression quantitative trait loci (eQTL) studies. These genetic variants must meet three key assumptions: they must be robustly associated with TMEM80 expression, not related to confounding factors, and affect the outcome only through TMEM80 expression. To address potential horizontal pleiotropy, where genetic variants affect the outcome through pathways other than TMEM80, researchers should employ advanced MR methods such as PMR-Egger or MRAID, which explicitly model pleiotropy. Tissue-specific approaches using methods like MR-MtRobin can further refine the analysis by examining TMEM80 expression effects in disease-relevant tissues, potentially revealing context-dependent causal relationships .

What are the implications of chemical compound interactions with TMEM80 for drug development research?

The documented interactions between chemical compounds and TMEM80 expression hold significant implications for drug development research. The bidirectional regulation of TMEM80 by diverse compounds suggests potential involvement in xenobiotic response pathways that could affect drug metabolism or efficacy. For instance, compounds like 1,2-dichloroethane increase TMEM80 expression, while others like aflatoxin B1 decrease it, indicating possible roles in toxicological responses . Researchers developing therapeutics should consider screening candidate compounds for effects on TMEM80 expression, particularly if targeting diseases where membrane protein dysfunction is implicated. These interactions might also suggest TMEM80 itself as a druggable target, especially if its expression changes correlate with disease states. Additionally, understanding how TMEM80 responds to chemical exposure could help predict potential off-target effects or drug-drug interactions, leading to more refined pharmacological profiles during drug development .

How might TMEM80 function differ across human tissue types based on expression data from model organisms?

TMEM80 function likely exhibits significant tissue specificity based on its varied expression patterns across different tissues in model organisms. In Xenopus studies, TMEM80 expression was documented in diverse tissues including neural structures (eye, head region), excretory organs (pronephric kidney, pronephric duct), digestive tract (intestine), and reproductive organs (testis) . This diverse expression pattern suggests tissue-specialized roles that may be conserved in humans. In excretory tissues, TMEM80 might function in transport processes or ion homeostasis, while in neural tissues, it could participate in signaling pathways or membrane organization. The presence in reproductive organs suggests potential roles in gamete development or function. Researchers investigating human TMEM80 should consider these tissue-specific contexts when designing experiments, potentially focusing on cell types that model these diverse tissues. Single-cell transcriptomics approaches could further reveal cell-type specific expression patterns within tissues, providing deeper insights into context-dependent functions .

What are the common challenges in producing functional recombinant TMEM80 and how can they be addressed?

Producing functional recombinant TMEM80 presents several challenges inherent to transmembrane proteins. The hydrophobic nature of transmembrane domains often leads to protein aggregation, misfolding, or inclusion body formation. To address this, researchers should consider using specialized expression systems like mammalian or insect cells that better handle membrane protein folding. Incorporating fusion partners such as MBP (maltose-binding protein) or SUMO may enhance solubility. For extraction, mild detergents like DDM, LMNG, or GDN generally preserve membrane protein structure better than harsh detergents like SDS. If traditional approaches fail, cell-free expression systems with supplied lipids or nanodiscs can provide alternative environments for proper folding. Additionally, expression at lower temperatures (16-30°C depending on the system) often improves folding by slowing production rates. Finally, systematic optimization of conditions including induction timing, detergent screening, and buffer composition is essential for each new construct .

How can researchers reconcile contradictory data regarding TMEM80 function across different experimental models?

Reconciling contradictory data regarding TMEM80 function requires a systematic analytical approach. First, carefully evaluate the experimental contexts, including cell/tissue types, species differences, and expression levels, as TMEM80 function may be context-dependent based on its diverse tissue expression . Second, assess methodological differences, as varying techniques (overexpression vs. knockdown/knockout, in vitro vs. in vivo) may capture different aspects of TMEM80 biology. Third, consider post-translational modifications or interacting partners that might differ between experimental systems, potentially altering TMEM80 function. Fourth, examine temporal aspects, as TMEM80's role might change during development or under different physiological conditions. For seemingly irreconcilable contradictions, design experiments specifically addressing the discrepancy, such as direct comparisons in identical systems or utilizing complementary approaches. Finally, consider that apparent contradictions might actually reveal multifunctional properties of TMEM80, with different functions predominating under different conditions .

What strategies can overcome the limitations of current analytical tools in studying TMEM80 interactions with chemical compounds?

Current analytical limitations in studying TMEM80-chemical compound interactions can be addressed through several innovative strategies. To overcome sensitivity issues in detecting subtle expression changes, researchers should employ digital PCR or single-cell RNA sequencing technologies that provide greater precision than traditional qPCR. For understanding direct binding versus indirect effects, photoaffinity labeling with chemically modified compounds followed by mass spectrometry can identify direct interaction sites. To address the complex nature of chemical effects, high-content imaging with fluorescently tagged TMEM80 can monitor real-time localization changes in response to compounds. Computational approaches like molecular docking and molecular dynamics simulations can predict binding sites and conformational changes. For comprehensive analysis of downstream effects, multi-omics approaches integrating transcriptomics, proteomics, and metabolomics data provide a systems-level view of how TMEM80-compound interactions affect cellular pathways. Additionally, CRISPR-mediated precise genomic editing can create specific TMEM80 variants to map compound interaction domains .

How should researchers interpret TMEM80 expression changes in response to chemical exposure?

Interpreting TMEM80 expression changes in response to chemical exposure requires careful consideration of multiple factors. First, establish dose-response relationships to determine if changes follow hormetic, linear, or threshold patterns, as this provides insights into biological relevance. For instance, the documented increases in TMEM80 expression with 1,2-dichloroethane and decreases with aflatoxin B1 may represent different cellular response mechanisms . Second, evaluate temporal dynamics through time-course experiments to distinguish between direct and secondary effects. Third, contextualize findings within relevant signaling pathways by performing parallel analysis of known stress response genes or pathway members. Fourth, consider cell-type specificity, as effects may vary across tissues based on TMEM80's diverse expression pattern . Fifth, validate findings across multiple experimental systems to ensure robustness. Finally, employ bioinformatic approaches like gene set enrichment analysis to place expression changes within broader biological contexts. This comprehensive approach helps distinguish between adaptive responses, toxicological effects, and potential therapeutic opportunities .

What statistical approaches are most appropriate for analyzing TMEM80 expression data across different experimental conditions?

When analyzing TMEM80 expression data across different experimental conditions, several statistical approaches should be considered based on experimental design and data characteristics. For comparing expression across multiple treatment groups, ANOVA followed by appropriate post-hoc tests (Tukey's HSD, Dunnett's test for comparisons against control) provides robust analysis while controlling for multiple comparisons. For time-course experiments, repeated measures ANOVA or mixed-effects models account for within-subject correlations. When analyzing dose-response relationships, non-linear regression models are often more appropriate than linear approaches, as biological responses frequently follow sigmoidal patterns. For complex experimental designs with multiple factors, two-way or three-way ANOVA with interaction terms can reveal condition-specific effects. When working with non-normally distributed data, non-parametric alternatives like Kruskal-Wallis or permutation tests should be employed. For high-dimensional datasets, methods controlling false discovery rate (Benjamini-Hochberg procedure) are essential. Finally, power analysis should be conducted a priori to ensure sufficient sample sizes for detecting biologically relevant expression changes .

How can researchers leverage existing gene-chemical interaction databases to predict novel TMEM80 interactions?

Researchers can strategically leverage existing gene-chemical interaction databases to predict novel TMEM80 interactions through several sophisticated approaches. First, employ similarity-based methods by identifying chemicals with known effects on TMEM80 (such as 1,2-dichloroethane or aflatoxin B1) and searching for structurally similar compounds through chemical fingerprinting algorithms and Tanimoto coefficients. Second, implement pathway-based approaches by mapping TMEM80 to biological pathways and identifying compounds known to modulate these pathways. Third, utilize network-based predictions by constructing gene-chemical interaction networks where TMEM80 and its interacting partners are nodes, allowing for identification of compounds that affect multiple nodes within TMEM80's network neighborhood. Fourth, apply machine learning algorithms trained on existing gene-chemical interaction data to predict novel interactions based on chemical descriptors and biological features. Fifth, conduct cross-species extrapolation by leveraging the documented interactions in model organisms like rats to predict human TMEM80 interactions. Finally, integrate evidence across multiple databases (CTD, DrugBank, STITCH) using weighted scoring systems that prioritize predictions supported by multiple lines of evidence .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.