Recombinant Human Transmembrane protein 88 (TMEM88)

Shipped with Ice Packs
In Stock

Description

Introduction

Transmembrane protein 88 (TMEM88) is a protein-coding gene in humans that has been identified as a regulator in several biological processes, including Wnt signaling, cardiovascular development, and tumor progression . TMEM88, a member of the transmembrane protein family, was first identified in 2010 and recognized as a disheveled-binding protein . This protein has garnered attention for its diverse roles in both normal development and disease, making it a potential therapeutic target in certain cancers .

Gene and Protein Characteristics

The TMEM88 gene encodes a transmembrane protein with multiple functional implications . Studies suggest TMEM88 interacts with the cytoplasmic Dvl protein, modulating Wnt signaling, a key pathway involved in cell proliferation, differentiation, and apoptosis . The expression of the TMEM88 gene correlates with that of components of the Wnt pathways, suggesting that TMEM88 binds Dvl to modulate Wnt signaling .

Role in Wnt Signaling

TMEM88's most characterized function is its involvement in the Wnt/β-catenin signaling pathway . It typically acts as a suppressor of this pathway . The Wnt pathway is crucial for embryonic development and tissue homeostasis, and its dysregulation is implicated in various diseases, including cancer .

TMEM88 and Wnt Signaling Interaction

ComponentInteraction with TMEM88Effect on Wnt Signaling
Disheveled (Dvl)Binds to the PDZ domain of DvlAttenuates Wnt/β-catenin signaling
Wnt-1 ligandSuppresses Wnt/β-catenin signaling induced by Wnt-1
TCF/LEFReduces transcriptional activity
c-Myc and cyclin D1Inhibits expression of downstream target genes
GSK-3β (Ser9 site)Inhibits activation of the Wnt/β-catenin signaling pathway by reducing the phosphorylation level of GSK-3β

Function in Cardiovascular Development

Research indicates TMEM88 plays a role in cardiovascular development and physiology . Studies using CRISPR interference (CRISPRi) to knockdown TMEM88 in human induced pluripotent stem cells (hiPSCs) have demonstrated its impact on cardiovascular cell differentiation .

  • Differentiation Impact Knocking down TMEM88 perturbs multilineage cell differentiation, leading to persistence of lateral plate and paraxial mesoderm, and depletion of endothelium and posterior foregut and liver bud progenitor cell types .

  • Mouse Model Validation Experiments using Tmem88 knockout mice revealed significant changes in organ volumes and structures, including the vertebrae, pelvic girdle, and ductus arteriosus .

  • Blood Pressure Regulation Tmem88 knockout mice exhibit increased variability in systolic and diastolic blood pressure, suggesting TMEM88's role in the developmental regulation of blood pressure .

Involvement in Cancer

Altered TMEM88 expression has been observed in several malignancies, suggesting its involvement in tumor progression . TMEM88 has been identified to be involved in cell proliferation, differentiation, apoptosis, and tumor progression .

TMEM88 Expression and Correlation with Clinicopathological Features in HCC

Role in Immune Response

TMEM88 participates in inflammatory responses . For instance, it promotes TNF-α-induced secretion of inflammatory factors in human hepatic stellate cells . In the HCC tumor microenvironment, TMEM88 levels correlate with immune cell enrichment, showing positive correlations with NK cell, pDC cell, and CD8+ T cell enrichment, and a negative correlation with Th2 cell enrichment .

Therapeutic Potential

Given its involvement in cancer and other diseases, TMEM88 is being explored as a potential therapeutic target . Its role in modulating the Wnt signaling pathway and its impact on tumor growth and metastasis make it an attractive target for cancer therapy .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
TMEM88; TMEM88A; Transmembrane protein 88
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-159
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMEM88
Target Protein Sequence
MADVPGAQRAVPGDGPEPRDPLDCWACAVLVTAQNLLVAAFNLLLLVLVLGTILLPAVTM LGFGFLCHSQFLRSQAPPCTAHLRDPGFTALLVTGFLLLVPLLVLALASYRRLCLRLRLA DCLVPYSRALYRRRRAPQPRQIRASPGSQAVPTSGKVWV
Uniprot No.

Target Background

Function

Recombinant Human Transmembrane protein 88 (TMEM88) inhibits the Wnt/β-catenin signaling pathway. It plays a critical role in heart development, functioning downstream of GATA factors in the pre-cardiac mesoderm to specify cardiomyocyte lineage commitment.

Gene References Into Functions
Published Research on TMEM88 Function:
  1. TMEM88 inhibits TGF-β1-stimulated cell proliferation, migration, and extracellular matrix expression in keloid fibroblasts. PMID: 28946191
  2. TMEM88, CCL14, and CLEC3B gene expression levels are stable and predictive of hepatocellular carcinoma survival and palindromia time, suggesting their potential as prognostic biomarkers. PMID: 28718365
  3. Ovarian cancer platinum resistance correlates with TMEM88 overexpression, potentially regulated by decreased promoter methylation. This suggests TMEM88 functions as a Wnt signaling inhibitor contributing to platinum resistance development. PMID: 27374141
  4. TMEM88 interaction with DVL1 stimulates triple-negative breast cancer cell invasion. PMID: 26325443
  5. TMEM88 mislocalization to the cytosol in non-small cell lung cancer cells abolishes its Wnt pathway regulatory function, promoting invasion and metastasis through p38-GSK3β-Snail pathway activation. PMID: 26359454
  6. TMEM88 is essential for heart development, acting downstream of GATA factors in the pre-cardiac mesoderm to specify cardiomyocyte lineage commitment. PMID: 23924634
  7. miRNA-708 acts as an oncogene, promoting tumor growth and progression by directly downregulating TMEM88. PMID: 22573352
  8. TMEM88 associates with Dvl proteins and regulates Wnt signaling in a context-dependent manner. PMID: 21044957
Database Links

HGNC: 32371

OMIM: 617813

KEGG: hsa:92162

STRING: 9606.ENSP00000301599

UniGene: Hs.389669

Protein Families
TMEM88 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is TMEM88 and what is its basic structure?

TMEM88 is a double-transmembrane protein that plays critical roles in regulating multiple cellular processes including proliferation, differentiation, apoptosis, and tumor progression. Structurally, TMEM88 contains two transmembrane domains with a C-terminal VWV (Val-Trp-Val) sequence that is crucial for its interaction with the PDZ domain of Dishevelled-1 (Dvl-1) . This protein is widely distributed in various cell types and tissues throughout the human body. The protein's structure enables it to function as a mediator between membrane-associated signals and intracellular signaling cascades. TMEM88's transmembrane orientation allows it to respond to extracellular stimuli and transduce signals to intracellular pathways, making it a key component in cellular communication networks .

Which signaling pathways does TMEM88 primarily interact with?

TMEM88 primarily interacts with and regulates the Wnt/β-catenin signaling pathway, which is a fundamental pathway involved in embryonic development and cancer progression. This interaction occurs through TMEM88's binding with the PDZ domain of Dishevelled-1 (Dvl-1), a key component of Wnt signaling . Research has demonstrated that TMEM88 can either inhibit or promote Wnt/β-catenin signaling depending on its subcellular localization and cellular context. In addition to the canonical Wnt pathway, TMEM88 may also influence non-canonical Wnt signaling cascades and potentially intersect with other pathways such as JNK signaling . The complex interplay between TMEM88 and these signaling networks contributes to its diverse effects on cellular functions and disease progression.

How does TMEM88 expression vary across normal tissues?

TMEM88 expression demonstrates significant tissue-specific patterns in normal physiological conditions. The protein has been found to play important roles in cardiac development, where it influences cardiomyocyte differentiation and function . Additionally, TMEM88 is involved in the activation of hematopoietic stem cells, contributing to blood cell development and homeostasis. In normal tissues, TMEM88 expression is typically well-regulated and contributes to proper tissue development and maintenance. Expression levels vary across different tissue types, with some tissues showing higher baseline expression than others. Understanding these normal expression patterns is crucial for interpreting the significance of altered TMEM88 expression in pathological conditions, as deviations from normal expression levels may contribute to disease states including cancer and inflammatory conditions .

How does TMEM88 expression differ across various cancer types?

TMEM88 expression exhibits remarkable heterogeneity across different cancer types, functioning in a highly context-dependent manner. In breast cancer, studies have shown significantly elevated expression in 71.22% of cancer tissues compared to only 11.4% in normal tissues, with particularly high expression in invasive ductal carcinoma . Conversely, in thyroid cancer, TMEM88 levels are markedly decreased in both patient specimens and cell lines including BCPAP, TPC1, K1, and NPA87 . In lung cancer, particularly non-small cell lung cancer (NSCLC), immunohistochemical analysis of 214 cases revealed that TMEM88 is overexpressed compared to adjacent normal tissues, with high cytoplasmic expression correlating with tissue differentiation, lymph node metastasis, and tumor stage . Similarly, bladder cancer tissues show significantly reduced TMEM88 expression compared to normal tissues according to bioinformatic analyses of the GEPIA2 and ENCORI databases .

What is the relationship between TMEM88 and chemotherapy resistance in cancer?

TMEM88 has been identified as a significant factor in chemotherapy resistance, particularly in ovarian cancer. Research has demonstrated significantly increased TMEM88 levels in platinum-resistant ovarian cancer xenograft models, platinum-resistant cell lines, and recurrent ovarian cancer tissues . The mechanistic basis for this relationship lies in TMEM88's ability to inhibit canonical Wnt/β-catenin signaling through its interaction with the PDZ domain of Dishevelled-1. When TMEM88 is silenced, this inhibition is alleviated, leading to increased expression of downstream target genes including c-Myc and β-catenin, which enhances ovarian cancer cell proliferation and restores platinum sensitivity . Furthermore, TMEM88 overexpression induces cell dormancy, allowing cancer cells to evade the cytotoxic effects of chemotherapy and potentially serving as a trigger for tumor recurrence. These findings suggest that TMEM88 may serve as both a biomarker for predicting chemotherapy response and a potential therapeutic target for overcoming drug resistance in ovarian cancer treatment protocols .

How does subcellular localization affect TMEM88 function in cancer cells?

The subcellular localization of TMEM88 plays a crucial role in determining its functional impact on cancer progression, with distinct and sometimes opposing effects depending on whether it localizes to the cytoplasm or nucleus. In breast cancer studies, researchers found that cytoplasmic TMEM88 positively correlates with advanced TNM stage (P = 0.038) and lymph node metastasis (P = 0.01), suggesting a tumor-promoting role . Conversely, nuclear localization of TMEM88 inversely correlates with lymph node metastasis (P = 0.046), indicating a potential tumor-suppressive function . Mechanistically, when TMEM88 colocalizes with Dvl in the cytoplasm of breast cancer cells (MDA-MB-231 and MCF-7), it promotes the expression of Snail protein while inhibiting Zo-1 and Occludin expression, thereby influencing cancer cell invasion and metastasis. This compartmentalization effect highlights the complex nature of TMEM88's role in cancer biology and underscores the importance of considering subcellular distribution when evaluating its potential as a therapeutic target or prognostic marker .

What are the recommended techniques for detecting and quantifying TMEM88 in tissue samples?

For comprehensive analysis of TMEM88 expression in tissue samples, researchers should employ multiple complementary techniques to ensure accurate detection and quantification. Immunohistochemistry (IHC) represents the gold standard for visualizing TMEM88 expression patterns in tissue sections, allowing researchers to assess both expression levels and subcellular localization with specific antibodies validated for TMEM88 detection . This approach has been successfully used in studies examining TMEM88 expression across multiple cancer types including breast, lung, and thyroid cancers. Quantitative reverse transcription PCR (qRT-PCR) provides a sensitive method for measuring TMEM88 mRNA levels, which can reveal transcriptional regulation patterns that may not be apparent at the protein level . Western blotting offers protein-level quantification that complements mRNA analysis and can detect post-translational modifications or protein variants. For large-scale analyses, researchers should consider microarray analysis or RNA sequencing approaches, which have been utilized in studies identifying TMEM88 as differentially expressed in cancer versus normal tissues .

What experimental approaches are most effective for studying TMEM88 function in vitro?

To effectively investigate TMEM88 function in vitro, researchers should implement a multi-faceted experimental approach combining genetic manipulation with functional assays. Gene knockdown via siRNA or shRNA techniques has proven effective for studying loss-of-function effects, while vector-based overexpression systems allow for gain-of-function studies . CRISPR-Cas9 gene editing offers more precise genetic manipulation for creating stable TMEM88 knockout or knock-in cellular models. Following genetic manipulation, proliferation assays such as the Cell Counting Kit-8 (CCK-8) and colony formation assays can effectively measure changes in cellular growth dynamics . Migration and invasion assays, including transwell and wound healing assays, are crucial for assessing metastatic potential, particularly relevant given TMEM88's association with cancer progression. Co-immunoprecipitation experiments are essential for investigating protein-protein interactions, especially with Dvl and other Wnt pathway components. Reporter assays using TCF/LEF responsive elements can quantify effects on Wnt/β-catenin signaling activity . Cell cycle analysis by flow cytometry is particularly important given TMEM88's role in regulating the proportion of S-phase cells, as demonstrated in ovarian cancer studies .

What are the key considerations for developing animal models to study TMEM88 function?

When developing animal models to study TMEM88 function, researchers must consider several critical factors to ensure physiological relevance and translational value. Selection of an appropriate model organism is the first consideration, with xenograft models in immunodeficient mice being commonly used for cancer studies, as demonstrated in work examining TMEM88's role in platinum-resistant ovarian cancer . For more sophisticated investigations, researchers should consider genetic models including conditional knockout or knock-in mice that allow tissue-specific and temporally controlled manipulation of TMEM88 expression. Given TMEM88's involvement in developmental processes including cardiomyocyte development and hematopoietic stem cell activation, embryonic studies may be particularly informative . When designing xenograft studies, researchers should carefully select cell lines with well-characterized TMEM88 expression profiles and consider both subcutaneous and orthotopic implantation approaches to account for microenvironmental influences. Monitoring parameters should include not only tumor growth metrics but also molecular analyses of signaling pathway activation, particularly Wnt/β-catenin signaling components, and assessment of metastatic potential .

How does TMEM88 methylation status influence its expression and function in different cancers?

DNA methylation of the TMEM88 gene represents a critical epigenetic mechanism regulating its expression and functional impact across cancer types. While specific methylation patterns of TMEM88 have not been comprehensively characterized in all cancer types, research indicates that abnormal methylation significantly influences TMEM88 expression levels . DNA methyltransferases, particularly Dnmt3a, may play a role in regulating TMEM88 methylation status in response to inflammatory stimuli or other microenvironmental factors. The downstream consequences of altered methylation likely include dysregulation of the Wnt/β-catenin signaling pathway, potentially affecting cell proliferation, invasion, and drug resistance phenotypes. Future research should employ high-throughput DNA methylation analysis techniques to map the specific CpG islands in the TMEM88 promoter region that are differentially methylated in cancer versus normal tissues, and correlate these patterns with expression levels and clinical outcomes . Additionally, investigating the interplay between methylation and other epigenetic modifications, such as histone modifications, could provide more comprehensive understanding of TMEM88 regulation in cancer pathogenesis.

What is the role of TMEM88 in cancer stem cell maintenance and therapy resistance?

TMEM88 appears to play a significant role in cancer stem cell (CSC) biology and therapy resistance, particularly through its regulatory effects on Wnt signaling and cell dormancy mechanisms. In ovarian cancer studies, TMEM88 overexpression has been shown to induce cell dormancy, which helps cancer cells evade chemotherapy-induced cell death and potentially contributes to tumor recurrence . This dormancy-inducing capacity suggests TMEM88 may help maintain a reservoir of cancer stem-like cells that can reinitiate tumor growth after treatment. The relationship between TMEM88 and stemness markers such as CD44, CD133, ALDH1, and SOX2 requires further investigation to fully understand its contribution to the cancer stem cell phenotype. Given that Wnt/β-catenin signaling is a key pathway in stem cell maintenance across multiple tissue types, TMEM88's modulation of this pathway likely impacts CSC self-renewal and differentiation capacities . Future research should explore whether targeting TMEM88 could sensitize cancer stem cells to conventional therapies, potentially through reversing dormancy states or modulating stemness-associated signaling networks.

How does TMEM88 influence the tumor microenvironment and immune response?

The potential influence of TMEM88 on the tumor microenvironment (TME) and anti-tumor immune responses represents an emerging area of research that warrants further investigation. While direct evidence of TMEM88's impact on immune components is limited in current literature, several mechanistic connections suggest significant immunomodulatory potential. TMEM88 has been implicated in inflammatory processes, which likely extends to regulation of inflammatory signaling within the TME . The Wnt/β-catenin pathway, which TMEM88 modulates, plays established roles in regulating immune cell function, particularly dendritic cell and T-cell activities, suggesting TMEM88 may indirectly shape anti-tumor immunity through this mechanism. Additionally, TMEM88's involvement in epithelial-mesenchymal transition (EMT) processes, particularly through regulation of factors like Snail, Zo-1, and Occludin in breast cancer, may alter tumor cell immunogenicity and interactions with immune cells . Future research should explore TMEM88 expression in tumor-associated stromal cells, including cancer-associated fibroblasts and tumor-associated macrophages, and investigate correlations between TMEM88 expression patterns and tumor infiltrating lymphocyte profiles, PD-L1 expression, and response to immunotherapies.

What role does TMEM88 play in embryonic development and lineage specification?

Recent research has identified TMEM88 as a critical regulator of mesendodermal lineage specification during embryonic development. The 2025 study published in Nature Communications provides compelling evidence that TMEM88 functions as a regulator of mesendodermal lineages with influence on cardiovascular and anthropometric traits . Through careful analysis of pluripotent stem cell differentiation across an eight-day time course with modulation of WNT, BMP, and VEGF signaling pathways, researchers demonstrated that TMEM88 acts as a WNT-inhibitor gene that impacts differentiation toward specific developmental lineages . Genetic loss-of-function models revealed that TMEM88 deficiency impairs proper differentiation of endodermal lineages, highlighting its essential role in early embryonic patterning and tissue specification . Earlier studies had already established TMEM88's involvement in cardiac development through regulation of cardiomyocyte differentiation and function, reinforcing its importance in mesoderm-derived tissues . Together, these findings position TMEM88 as a key developmental regulator that helps orchestrate the complex process of lineage commitment and differentiation during embryogenesis.

How can TMEM88 be leveraged in directed differentiation protocols for stem cells?

TMEM88's role as a regulator of mesendodermal lineage differentiation makes it a valuable target for optimizing directed differentiation protocols in stem cell research. Based on the 2025 Nature Communications study, researchers developing differentiation protocols should consider TMEM88 expression levels as a potential marker for successful lineage commitment, particularly when aiming to generate cardiovascular and endodermal derivatives . Manipulation of TMEM88 expression, either through genetic approaches or small molecule modulators, could enhance differentiation efficiency toward specific lineages of interest. Given TMEM88's established interaction with the Wnt signaling pathway, researchers should consider coordinating TMEM88 manipulation with timed modulation of Wnt pathway activity to achieve optimal differentiation outcomes . Additionally, monitoring TMEM88 subcellular localization during differentiation may provide insights into the quality and progression of lineage specification, as its cytoplasmic versus nuclear distribution appears to correlate with different functional outcomes . The development of reporter systems for TMEM88 expression or activity could serve as valuable tools for real-time assessment of differentiation progress in stem cell cultures.

What methodologies are recommended for studying TMEM88 in pluripotent stem cell models?

When investigating TMEM88 in pluripotent stem cell models, researchers should employ a comprehensive methodological approach that captures both temporal dynamics and signaling interactions. The 2025 study exemplifies an effective strategy by using barcoded induced pluripotent stem cells to generate an atlas of multilineage differentiation, incorporating modulation of key signaling pathways (WNT, BMP, and VEGF) across an eight-day time course . Single-cell RNA sequencing represents a particularly valuable technique for these studies, allowing researchers to capture cell type-specific expression patterns and differentiation trajectories at high resolution. CRISPR-Cas9 gene editing for generating TMEM88 knockout or knock-in stem cell lines provides a powerful tool for loss-of-function and gain-of-function studies . When analyzing differentiation outcomes, researchers should employ a combination of molecular markers (both at RNA and protein levels), morphological assessments, and functional assays specific to the lineages of interest. Comparison of in vitro differentiation with in vivo developmental processes, as demonstrated in the 2025 study's annotation of cell types with reference to in vivo development, enhances the physiological relevance of findings .

What approaches are being developed to target TMEM88 for cancer therapy?

While TMEM88-specific therapeutics remain in early developmental stages, several theoretical approaches warrant exploration based on current understanding of TMEM88 biology. Small molecule inhibitors designed to disrupt the interaction between TMEM88 and Dishevelled-1 represent a promising approach, particularly for cancers where TMEM88 promotes tumor growth through Wnt pathway modulation . Alternatively, in cancers where TMEM88 functions as a tumor suppressor, therapeutic strategies might focus on restoring or enhancing TMEM88 expression through epigenetic modulators that reverse promoter hypermethylation. RNA interference-based approaches using siRNA or shRNA delivery systems could achieve targeted TMEM88 knockdown in tumors where it promotes cancer progression or therapy resistance . The differential effects of TMEM88 depending on its subcellular localization suggest that compounds directing TMEM88 to either nuclear or cytoplasmic compartments might offer therapeutic benefit in specific cancer contexts. Additionally, combination approaches targeting TMEM88 alongside conventional chemotherapeutics might prove particularly effective for overcoming drug resistance, as suggested by studies showing that TMEM88 knockdown can resensitize platinum-resistant ovarian cancer cells .

How can TMEM88 expression be used as a prognostic or predictive biomarker in cancer?

TMEM88 shows considerable promise as both a prognostic and predictive biomarker in multiple cancer types, though its utility must be contextualized to specific cancer types and treatment scenarios. In ovarian cancer, elevated TMEM88 expression correlates with platinum resistance and increased recurrence risk, suggesting its potential as a predictive biomarker for chemotherapy response and as a prognostic indicator for patient outcomes . For breast cancer, the subcellular localization pattern of TMEM88 appears more informative than total expression levels, with cytoplasmic localization correlating with advanced TNM stage and lymph node metastasis, while nuclear localization shows inverse correlation with metastasis . This pattern indicates that assessment of subcellular distribution might enhance the prognostic value of TMEM88 in breast cancer patients. In NSCLC, high cytoplasmic TMEM88 expression correlates with tissue differentiation, lymph node metastasis, and tumor stage, highlighting its potential as a prognostic marker in this cancer type . For clinical implementation, standardized immunohistochemical protocols with attention to subcellular localization patterns, potentially combined with gene expression analysis, would be required to maximize the biomarker utility of TMEM88 across cancer types.

What potential side effects might arise from therapeutically targeting TMEM88?

Therapeutic targeting of TMEM88 would require careful consideration of potential side effects based on its physiological roles in normal tissues. Given TMEM88's involvement in cardiomyocyte development and function, cardiovascular effects represent a primary concern for any TMEM88-targeted therapy . Patients might require cardiac monitoring during treatment to detect early signs of cardiotoxicity. Similarly, TMEM88's role in hematopoietic stem cell activation suggests that hematological side effects, including potential impacts on blood cell production and immune function, should be monitored closely . The recent identification of TMEM88 as a regulator of mesendodermal lineages influencing cardiovascular and anthropometric traits further underscores potential developmental concerns, particularly for pediatric patients or patients of reproductive age . The tissue-specific and context-dependent functions of TMEM88 suggest that therapeutic approaches may need to employ targeted delivery systems to minimize systemic effects. Additionally, given TMEM88's complex role in Wnt signaling, a pathway with numerous physiological functions, downstream effects on tissue homeostasis in Wnt-dependent organs such as intestine, skin, and bone should be carefully evaluated during preclinical and clinical development of any TMEM88-targeted therapy .

What are the most pressing unanswered questions regarding TMEM88 biology?

Despite significant advances in understanding TMEM88 function, several fundamental questions remain unexplored. The tissue-specific expression patterns and distinctive functional outcomes of TMEM88 across different cancer types require mechanistic explanation – what cellular or molecular factors determine whether TMEM88 acts as a tumor suppressor or promoter in a given context? The specific upstream regulators governing TMEM88 expression under both physiological and pathological conditions remain largely unknown, including transcriptional regulators, post-transcriptional mechanisms, and epigenetic influences. Similarly, the complete repertoire of TMEM88-interacting proteins beyond Dishevelled remains to be fully characterized, which could reveal additional signaling pathways influenced by TMEM88 . The evolutionary conservation of TMEM88 function across species and its potential roles beyond the currently studied tissue types represent additional knowledge gaps. The mechanisms controlling TMEM88's subcellular localization and how this compartmentalization affects its function require detailed investigation, particularly given the opposing effects of nuclear versus cytoplasmic TMEM88 in breast cancer . Finally, the 2025 study highlighting TMEM88's role in mesendodermal lineage specification opens new questions about its developmental functions and potential influences on human complex traits .

What technological advances might accelerate TMEM88 research in the near future?

Emerging technologies across multiple fields promise to accelerate TMEM88 research in the coming years. Advanced spatial transcriptomics and proteomics techniques will enable researchers to map TMEM88 expression with unprecedented spatial resolution within tissues, providing insights into its heterogeneous expression patterns and potential cellular interactions . CRISPR-based screening approaches, including CRISPRi and CRISPRa, offer opportunities to identify genetic modifiers of TMEM88 function and synthetic lethal interactions that could inform therapeutic strategies. Improved protein structural analysis methods, including cryo-electron microscopy and computational modeling, may reveal the three-dimensional structure of TMEM88 and its interaction interfaces with binding partners, potentially guiding structure-based drug design efforts . Organoid and microphysiological systems will enable more physiologically relevant studies of TMEM88 function in three-dimensional tissue contexts. Integration of single-cell multi-omics approaches, as exemplified in the 2025 study using barcoded induced pluripotent stem cells, will continue to reveal TMEM88's role in lineage specification and differentiation with unprecedented resolution . Additionally, the application of artificial intelligence and machine learning to analyze large-scale datasets may uncover previously unrecognized patterns in TMEM88 expression and function across diverse tissue types and disease states.

How can researchers collaborate more effectively on TMEM88 studies across disciplines?

Advancing TMEM88 research will require effective interdisciplinary collaboration spanning multiple research domains. The establishment of a dedicated TMEM88 research consortium would facilitate standardization of research methodologies, sharing of reagents such as validated antibodies and cell lines, and coordination of research priorities across laboratories . Development of shared databases for TMEM88 expression patterns, genetic variations, and functional outcomes across tissue types and disease states would accelerate knowledge integration. Collaborative funding initiatives specifically targeting TMEM88 research could incentivize partnerships between cancer biologists, developmental biologists, structural biologists, and clinicians. Cross-disciplinary training programs would help researchers develop the diverse skill sets needed to address the multifaceted aspects of TMEM88 biology . Regular workshops and conferences focused on transmembrane proteins in cancer and development would create opportunities for knowledge exchange and partnership formation. Technology sharing platforms, particularly for advanced methodologies like those used in the 2025 study's atlas of multilineage differentiation, would democratize access to cutting-edge approaches . Finally, early engagement with clinical researchers would help ensure that basic science discoveries about TMEM88 are designed with translational potential in mind, accelerating the path from laboratory findings to clinical applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.