Recombinant Human Transmembrane protein 89 (TMEM89)

Shipped with Ice Packs
In Stock

Description

Tissue-Specific Expression

TMEM89 is most abundant in the testis, with low-level expression in:

  • Stomach, kidneys, heart, ovaries, thyroid, colon, bone marrow, adrenal tissues .

  • Fetal tissues: Heart, stomach, kidney, intestine .

Immunohistochemical Localization

  • Membrane Localization: Observed in colon, fallopian tube, kidney, and testis .

  • Expression Clusters: Part of the Human Protein Atlas cluster 23 (SpermatidS - Flagellum & Golgi organization), linked to spermatogenesis .

Differential Expression

  • Upregulated in:

    • Amniotic fluid-derived cells (vs. immortalized cells) .

    • Macrophage migration inhibitory factor (MIF)-deficient cells .

  • Downregulated in: Cardiomyocytes from human embryonic stem cells .

Cancer Biology

  • Biomarker Potential:

    • Upregulated in upper tract urothelial carcinomas, suggesting diagnostic utility .

    • Testicular Germ Cell Tumors (TGCTs):

      • Included in an 8-gene risk score model for predicting relapse in stage I TGCTs.

      • Formula:

        Risk Score=(1.0862306×TMEM89)+(other terms)\text{Risk Score} = (-1.0862306 \times \text{TMEM89}) + \text{(other terms)}
      • Low TMEM89 expression correlates with high-risk relapse .

Study TypeTMEM89 RoleOutcomeSource
TGCT PrognosisProtective biomarkerLow expression = High relapse risk
Upper Tract Urothelial CarcinomaUpregulated in tumorsPotential diagnostic marker

Spermatogenesis

  • Marker for Late Spermatocytes:

    • Diakinesis to secondary spermatocytes: TMEM89 expression distinguishes this stage in yak testicular cells .

Toxicology

  • Chemical Interactions:

    • Downregulated by: Estradiol, bisphenol A, paracetamol .

    • Upregulated by: Aristolochic acid I, fenvalerate, titanium dioxide .

Research Challenges and Future Directions

  • Mechanistic Insights: Limited data on TMEM89’s role in signaling pathways or protein interactions beyond SH3 binding .

  • Therapeutic Potential: No direct therapeutic applications reported, but its involvement in cancer risk models suggests further exploration as a prognostic marker .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your requests to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
TMEM89; Transmembrane protein 89
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
25-159
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
TMEM89
Target Protein Sequence
RPLWYQVGLDLQPWGCQPKSVEGCRGGLSCPGYWLGPGASRIYPVAAVMITTTMLMICRKILQGRRRSQATKGEHPQVTTEPCGPWKRRAPISDHTLLRGVLHMLDALLVHIEGHLRHLATQRQIQIKGTSTQSG
Uniprot No.

Target Background

Database Links

HGNC: 32372

KEGG: hsa:440955

UniGene: Hs.631922

Subcellular Location
Membrane; Single-pass type I membrane protein.

Q&A

What is Human TMEM89 and what are its basic structural characteristics?

Transmembrane protein 89 (TMEM89) is a protein-coding gene that produces a transmembrane protein involved in cellular trafficking processes. Based on computational analysis of genomic sequences, TMEM89 contains a predicted open reading frame (ORF) of approximately 480 base pairs . The protein is characterized by transmembrane domains that anchor it within cellular membranes, with evidence suggesting its involvement in protein localization processes, particularly in regulating nuclear protein transport .

Research utilizing comparative genomic approaches has identified TMEM89 orthologs in various mammalian species, with the sequence in Bos mutus (wild yak) being well-documented in the NCBI Reference Sequence Database . While the exact three-dimensional structure remains to be fully elucidated, bioinformatic analyses suggest a topology consistent with other transmembrane regulatory proteins.

How is TMEM89 gene expression regulated in different tissue types?

TMEM89 expression exhibits tissue-specific patterns, with varying levels of expression across different human tissues. Although comprehensive expression profiling is still emerging, current research methodologies for investigating TMEM89 expression include:

  • RNA-Seq analysis of tissue samples to quantify transcript levels

  • Quantitative PCR to measure relative expression in different tissues

  • In situ hybridization to localize expression within specific tissue regions

When conducting expression studies, researchers should consider:

  • Including appropriate housekeeping genes as normalization controls

  • Comparing expression levels across multiple tissue types

  • Validating findings using complementary techniques

  • Controlling for variables such as age, sex, and health status of tissue donors

For reliable quantification, experimental designs should include statistical considerations for biological and technical replicates, with appropriate sample sizes determined through power analysis .

What cellular compartments contain TMEM89 and how can its localization be studied?

TMEM89 has been identified as participating in the negative regulation of protein localization to the nucleus, suggesting it plays a role in protein trafficking between cytoplasmic and nuclear compartments . To investigate TMEM89's subcellular localization, researchers can employ several methodological approaches:

TechniqueApplicationAdvantagesLimitations
ImmunofluorescenceVisualization of endogenous TMEM89Direct visualization in intact cellsRequires specific antibodies
Subcellular fractionationBiochemical isolation of membrane componentsQuantitative assessment possiblePotential cross-contamination
Epitope-tagged expressionTracking of recombinant TMEM89No need for specific antibodiesPotential artifact from overexpression
Live cell imagingDynamic localization studiesReal-time trafficking visualizationTechnical complexity

For optimal results, researchers should employ a combination of these techniques and include appropriate controls to validate findings across multiple experimental systems .

What expression systems are optimal for producing functional recombinant human TMEM89?

The selection of an appropriate expression system is critical for obtaining properly folded, functional recombinant TMEM89. Based on established protocols for transmembrane proteins and the available information on TMEM89, the following expression systems can be considered:

  • Mammalian expression systems (e.g., HEK293): These provide the most native environment for human protein production, enabling proper folding and post-translational modifications. HEK293 cells have been successfully used for related immunoglobulin receptor proteins .

  • Insect cell expression systems: The baculovirus expression vector system provides a eukaryotic environment suitable for complex transmembrane proteins.

  • Cell-free expression systems: These can be optimized for membrane protein production with the addition of lipids or detergents.

For optimal expression, researchers should:

  • Clone the full TMEM89 coding sequence (approximately 480bp) into an appropriate expression vector

  • Consider adding purification tags (e.g., polyhistidine) to facilitate isolation

  • Optimize expression conditions including temperature, induction time, and media composition

  • Validate proper folding through functional assays and structural analyses

Expression constructs should include the complete ORF sequence with careful consideration of codon optimization for the selected expression system .

How can researchers validate the proper folding and functionality of recombinant TMEM89?

Validating proper folding and functionality of recombinant TMEM89 requires a multi-faceted approach:

  • Structural validation:

    • Circular dichroism (CD) spectroscopy to assess secondary structure content

    • Limited proteolysis to probe folding and domain organization

    • Size exclusion chromatography to verify oligomeric state

  • Functional assays:

    • Protein-protein interaction studies with known binding partners

    • Nuclear localization regulation assays to test TMEM89's reported function in protein localization to the nucleus

    • Binding assays with potential ligands or receptors

  • Stability assessment:

    • Thermal shift assays to determine protein stability

    • Long-term storage tests under different conditions

Quality control metrics should include purity assessment by SDS-PAGE (>95% purity is typically targeted for research applications), endotoxin testing (<1.0 EU per μg is considered suitable for most applications), and verification of protein identity by mass spectrometry or Western blotting .

What is the role of TMEM89 in negative regulation of protein localization to the nucleus?

TMEM89 has been identified as a participant in the negative regulation of protein localization to the nucleus, functioning alongside other regulatory proteins such as FBXO4 and RAB23 . This function positions TMEM89 as a potential modulator of nuclear transport processes, with implications for gene expression regulation and cellular signaling.

To investigate this regulatory role, researchers should consider:

  • Protein interaction studies to identify binding partners in the nuclear transport machinery

  • CRISPR/Cas9-mediated knockout or knockdown studies to assess effects on nuclear protein distribution

  • Live-cell imaging with fluorescently tagged nuclear proteins to monitor transport kinetics in the presence or absence of TMEM89

  • Biochemical fractionation to quantify nuclear vs. cytoplasmic protein distributions

When designing experiments to study this function, researchers should implement a between-subjects design with appropriate controls, including:

  • Wild-type cells or tissues as baseline controls

  • TMEM89 knockout/knockdown samples

  • Rescue experiments with recombinant TMEM89 to confirm specificity

  • Positive controls using known regulators of nuclear transport

What controls should be included in experiments investigating TMEM89 function?

Proper experimental controls are essential for reliable investigation of TMEM89 function. A comprehensive experimental design should include:

  • Negative controls:

    • Empty vector controls in expression studies

    • Isotype controls for antibody-based detection

    • Vehicle-only treatments in stimulation experiments

    • Non-targeting siRNA or sgRNA in knockdown/knockout studies

  • Positive controls:

    • Known regulators of protein nuclear localization (for localization studies)

    • Well-characterized transmembrane proteins (for membrane isolation)

    • Established protocols with expected outcomes

  • Validation controls:

    • Multiple siRNA or sgRNA sequences targeting different regions of TMEM89

    • Rescue experiments with RNAi-resistant TMEM89 constructs

    • Dose-response relationships to establish specificity

The experimental design should systematically manipulate the independent variable (e.g., TMEM89 expression levels) while precisely measuring dependent variables (e.g., nuclear protein levels) and controlling for potential confounding variables .

How should researchers design experiments to investigate TMEM89's role in cellular signaling pathways?

Investigating TMEM89's role in cellular signaling requires careful experimental design:

  • Study design approach:

    • Between-subjects design: Compare different cell populations with varying TMEM89 expression levels

    • Within-subjects design: Track changes in signaling before and after TMEM89 manipulation in the same cells

  • Methodological considerations:

    • Temporal analysis: Monitor signaling dynamics at multiple time points

    • Dose-dependency: Evaluate effects across a range of TMEM89 expression levels

    • Pathway specificity: Examine effects on multiple signaling pathways to determine specificity

  • Analytical framework:

    • Phosphoproteomics to identify changes in phosphorylation cascades

    • Transcriptional profiling to detect downstream gene expression changes

    • Protein-protein interaction mapping to identify direct signaling partners

When analyzing data, researchers should consider pathway enrichment analysis to identify significantly affected signaling networks, with particular attention to pathways like MAPK signaling, which has been associated with related regulatory proteins .

What statistical considerations are important when analyzing TMEM89 expression data?

Statistical analysis of TMEM89 expression data requires careful consideration of several factors:

  • Sample size determination:

    • Power analysis should be conducted prior to experimentation to determine appropriate sample sizes

    • Consider effect size estimations based on preliminary data or related studies

    • Typically, larger sample sizes (n>15 per group) provide greater statistical power for detecting subtle effects

  • Data normalization:

    • Select appropriate reference genes for qPCR data normalization

    • Apply batch correction for multi-site or multi-timepoint studies

    • Consider logarithmic transformation for expression data that is not normally distributed

  • Statistical testing:

    • Apply appropriate parametric (e.g., t-test, ANOVA) or non-parametric tests based on data distribution

    • Control for multiple testing when examining TMEM89 expression across numerous conditions

    • Implement linear regression models with relevant covariates (age, sex, experimental site)

  • Validation strategies:

    • Split-sample validation using separate discovery and validation cohorts

    • Cross-validation techniques for predictive modeling

    • Independent validation using alternative methodologies

Researchers should report effect sizes alongside p-values and consider implementing randomization in their experimental design to minimize bias .

How can contradictory findings regarding TMEM89 function be reconciled?

When faced with contradictory findings regarding TMEM89 function, researchers should:

  • Systematically compare experimental conditions:

    • Cell types/tissues used (TMEM89 function may be context-dependent)

    • Expression levels (overexpression vs. endogenous)

    • Experimental techniques employed

    • Temporal aspects (acute vs. chronic effects)

  • Consider multiple hypotheses:

    • TMEM89 may have pleiotropic effects depending on cellular context

    • Different isoforms or post-translational modifications may exist

    • Compensatory mechanisms may mask effects in certain systems

  • Implement integrative approaches:

    • Meta-analysis of multiple datasets

    • Multi-omics integration (genomics, transcriptomics, proteomics)

    • Collaboration with other research groups to test hypotheses across different models

  • Design decisive experiments:

    • Create experimental paradigms that directly test competing hypotheses

    • Use genetic approaches (CRISPR/Cas9) to create defined models

    • Employ rescue experiments with varying TMEM89 constructs

The process of reconciling contradictory findings should be documented thoroughly to contribute to the evolving understanding of TMEM89 biology.

What bioinformatic tools are most useful for predicting TMEM89 structure and function?

Several bioinformatic tools can aid in predicting TMEM89 structure and function:

Tool CategoryExamplesApplication for TMEM89 Research
Transmembrane topology predictionTMHMM, Phobius, TOPCONSIdentify membrane-spanning regions
Protein structure predictionAlphaFold, RoseTTAFold, I-TASSERGenerate 3D structural models
Functional domain analysisInterPro, Pfam, SMARTIdentify conserved domains
Post-translational modification sitesNetPhos, NetOGlyc, NetNGlycPredict regulatory modification sites
Protein-protein interactionSTRING, BioGRID, IntActIdentify potential interaction partners
Evolutionary analysisPAML, MEGA, ConSurfDetect evolutionary constraints

When using these tools, researchers should:

  • Compare results across multiple prediction algorithms

  • Consider sequence conservation across species

  • Validate key predictions experimentally

  • Integrate structural predictions with functional data

Pathway enrichment analyses like those identifying TMEM89's involvement in protein localization to the nucleus can provide additional functional insights .

How can researchers integrate multi-omics data to understand TMEM89's role in biological processes?

Integration of multi-omics data can provide comprehensive insights into TMEM89 function:

  • Data types to consider:

    • Genomics: Identify genetic variants affecting TMEM89 expression or function

    • Transcriptomics: Analyze co-expression networks involving TMEM89

    • Proteomics: Map protein interactions and post-translational modifications

    • Metabolomics: Identify metabolic pathways affected by TMEM89 manipulation

  • Integration strategies:

    • Sequential analysis: Use findings from one data type to inform analysis of another

    • Parallel integration: Analyze multiple data types simultaneously to identify convergent evidence

    • Network-based approaches: Construct multi-level networks incorporating different data types

  • Methodological frameworks:

    • Supervised integration: Use prior knowledge to guide integration

    • Unsupervised approaches: Identify patterns across data types without prior assumptions

    • Semi-supervised methods: Combine known biology with data-driven discovery

For proper integration, researchers should consider implementing dimensionality reduction techniques, careful normalization across data types, and validation of findings through targeted experiments. Tools like Pathfinder can identify significantly enriched pathways, as demonstrated in studies of related regulatory systems .

What are the most promising therapeutic applications for targeting TMEM89?

Based on TMEM89's involvement in protein localization to the nucleus , several potential therapeutic applications emerge:

  • Cancer therapeutics:

    • Nuclear localization of transcription factors and oncoproteins is crucial in cancer progression

    • Modulating TMEM89 function could potentially alter cancer cell signaling

    • Targeted approaches could exploit cancer-specific dependencies on nuclear transport

  • Inflammatory disorders:

    • Nuclear translocation of transcription factors like NF-κB drives inflammatory responses

    • TMEM89's regulatory role could be leveraged to modulate inflammatory signaling

    • Targeting context-specific functions could provide tissue-selective effects

  • Neurological disorders:

    • Proper protein compartmentalization is critical for neuronal function

    • TMEM89's presence in brain tissue suggests potential neurobiological roles

    • Modulation could affect protein aggregation or mislocalization in neurodegenerative diseases

Future research should focus on establishing disease-specific roles of TMEM89 through conditional knockout models, patient-derived samples, and high-throughput screening for modulators of TMEM89 function or expression.

What emerging technologies will advance our understanding of TMEM89 biology?

Several emerging technologies hold promise for deepening our understanding of TMEM89:

  • Advanced imaging techniques:

    • Super-resolution microscopy for visualizing TMEM89 in membrane microdomains

    • Live-cell single-molecule tracking to monitor TMEM89 dynamics

    • Correlative light and electron microscopy to link function with ultrastructure

  • Genetic engineering approaches:

    • CRISPR-based screening to identify genetic interactions with TMEM89

    • Base editing for precise modification of TMEM89 regulatory elements

    • Optogenetic control of TMEM89 function for temporal studies

  • Structural biology advances:

    • Cryo-electron microscopy for high-resolution structure determination

    • Hydrogen-deuterium exchange mass spectrometry for dynamics analysis

    • Integrative structural biology combining multiple experimental approaches

  • Systems biology approaches:

    • Single-cell multi-omics to capture cell-type-specific functions

    • Spatial transcriptomics to map TMEM89 expression in tissue contexts

    • Machine learning for predicting context-dependent functions

Each of these technologies requires careful experimental design with appropriate controls and validation strategies to ensure reliable data interpretation .

What are the main challenges in producing high-quality antibodies against TMEM89?

Producing specific antibodies against transmembrane proteins like TMEM89 presents several challenges:

  • Antigen selection challenges:

    • Limited extracellular domains for antibody targeting

    • High sequence conservation across species complicating specificity

    • Conformational epitopes that may be lost in denatured protein

  • Validation challenges:

    • Cross-reactivity with related transmembrane proteins

    • Background signal from non-specific binding

    • Limited availability of knockout controls

  • Methodological solutions:

    • Use of multiple peptide antigens from different TMEM89 regions

    • Recombinant protein fragments expressed with proper folding

    • Extensive validation using multiple techniques and controls

A recommended validation pipeline includes Western blotting, immunoprecipitation, immunofluorescence with peptide competition, and testing in TMEM89 knockout/knockdown systems. For optimal results, researchers should produce antibodies against several epitopes and validate each for specific applications.

How can researchers overcome solubility and stability issues with recombinant TMEM89?

Transmembrane proteins like TMEM89 often present solubility and stability challenges that can be addressed through several approaches:

  • Expression optimization:

    • Use of specialized expression vectors with solubility-enhancing tags

    • Low-temperature induction to improve folding

    • Co-expression with chaperones to enhance proper folding

  • Purification strategies:

    • Careful detergent selection for membrane extraction

    • Gradient purification protocols to maintain native structure

    • Inclusion of stabilizing additives throughout purification

  • Storage considerations:

    • Optimized buffer composition with appropriate pH and ionic strength

    • Addition of glycerol or specific lipids to maintain structure

    • Aliquoting and flash-freezing to prevent freeze-thaw damage

  • Quality control:

    • Regular assessment of protein activity and structure

    • Thermal shift assays to monitor stability

    • Dynamic light scattering to detect aggregation

When working with recombinant TMEM89, researchers should aim for purity >95% as determined by SDS-PAGE and maintain endotoxin levels below 1.0 EU per μg for downstream functional studies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.