Recombinant Human Transmembrane protein 8A (TMEM8A)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquotting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference for your use.
Shelf Life
Shelf life is influenced by multiple factors including storage state, buffer components, storage temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is defined during production. If you have a specific tag type in mind, please communicate it to us, and we will prioritize development of the specified tag.
Synonyms
PGAP6; TMEM6; TMEM8; TMEM8A; Post-GPI attachment to proteins factor 6; GPI processing phospholipase A2; GPI-PLA2; Protein M83; Transmembrane protein 6; Transmembrane protein 8; Transmembrane protein 8A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
35-771
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
TMEM8A
Target Protein Sequence
GYSGKSEVGLVSEHFSQAPQRLSFYSWYGSARLFRFRVPPDAVLLRWLLQVSRESGAACT DAEITVHFRSGAPPVINPLGTSFPDDTAVQPSFQVGVPLSTTPRSNASVNVSHPAPGDWF VAAHLPPSSQKIELKGLAPTCAYVFQPELLVTRVVEISIMEPDVPLPQTLLSHPSYLKVF VPDYTRELLLELRDCVSNGSLGCPVRLTVGPVTLPSNFQKVLTCTGAPWPCRLLLPSPPW DRWLQVTAESLVGPLGTVAFSAVAALTACRPRSVTIQPLLQSSQNQSFNASSGLLSPSPD HQDLGRSGRVDRSPFCLTNYPVTREDMDVVSVHFQPLDRVSVRVCSDTPSVMRLRLNTGM DSGGSLTISLRANKTEMRNETVVVACVNAASPFLGFNTSLNCTTAFFQGYPLSLSAWSRR ANLIIPYPETDNWYLSLQLMCPENAEDCEQAVVHVETTLYLVPCLNDCGPYGQCLLLRRH SYLYASCSCKAGWRGWSCTDNSTAQTVAQQRAATLLLTLSNLMFLAPIAVSVRRFFLVEA SVYAYTMFFSTFYHACDQPGEAVLCILSYDTLQYCDFLGSGAAIWVTILCMARLKTVLKY VLFLLGTLVIAMSLQLDRRGMWNMLGPCLFAFVIMASMWAYRCGHRRQCYPTSWQRWAFY LLPGVSMASVGIAIYTSMMTSDNYYYTHSIWHILLAGSAALLLPPPDQPAEPWACSQKFP CHYQICKNDREELYAVT
Uniprot No.

Target Background

Function
TMEM8A plays a crucial role in the lipid remodeling steps of GPI-anchor maturation. These remodeling steps involve generating two saturated fatty chains at the sn-2 position of GPI-anchor proteins (GPI-AP). TMEM8A exhibits phospholipase A2 activity, removing an acyl-chain at the sn-2 position of GPI-anchors during GPI remodeling. This is essential for the shedding of the GPI-AP TDGF1 at the cell surface, though not for CFC1 shedding. The shedding of TDGF1 modulates Nodal signaling by enabling soluble TDGF1 to function as a Nodal coreceptor on other cells. Additionally, TMEM8A indirectly contributes to the translocation of RAC1 from the cytosol to the plasma membrane by maintaining the steady state amount of CAV1-enriched plasma membrane subdomains, thus stabilizing RAC1 at the plasma membrane. Unlike myomaker (TMEM8C), TMEM8A does not possess fusogenic activity.
Gene References Into Functions
  1. PGAP6 plays a crucial role in the modulation of Nodal signaling through the shedding of CRIPTO. PMID: 27881714
  2. TMEM8A protein localizes within lysosomes in HeLa cells. PMID: 21752829
Database Links

HGNC: 17205

KEGG: hsa:58986

STRING: 9606.ENSP00000401338

UniGene: Hs.288940

Protein Families
TMEM8 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in pancreas, placenta, spleen, liver, kidney, bone marrow, peripheral blood leukocytes and tonsil.

Q&A

What is the genomic and structural organization of TMEM8A?

TMEM8A (also known as PGAP6, M83, TMEM6, and TMEM8) is encoded by a gene located on chromosome 16 at position 16p13.3 in humans. The gene spans from base pair 420,773 to 437,113, making it 16,340 base pairs in length, and is found on the minus strand of the chromosome .

The protein contains five transmembrane domains and one EGF-like domain, all highly conserved among orthologs . Additionally, TMEM8A contains an unannotated N-terminal region and an EGF-like domain following the signal sequence for ER insertion . The mature TMEM8A protein typically appears as a 120-kD band (cell surface form) and a 90-kD band (ER-localized form) when analyzed by western blotting .

Key structural features include:

  • Five transmembrane domains with conserved catalytic amino acids

  • EGF-like domain

  • N-terminal region

  • Conserved putative catalytic amino acids within transmembrane domains at C-terminal regions

How did TMEM8A evolve across species and what are its orthologous relationships?

The evolutionary history of TMEM8A shows interesting species-specific adaptations. In chickens, TMEM8A (referred to as cTMEM8) was relocated to the vicinity of the α-globin cluster due to an inversion of a ~170-kb genomic fragment, which resulted in it acquiring an erythroid-specific expression profile - markedly different from its expression pattern in mammals .

The ortholog space of TMEM8A is relatively narrow, with orthologs primarily found in mammals and especially primates:

SpeciesCommon nameClassPercent identity
Pan troglodytesChimpanzeeMammalia99%
Pongo abeliiOrangutanMammalia97%
Macaca mulattaRhesus monkeyMammalia93%
Callithrix jacchusMarmosetMammalia93%
Bos taurusCowMammalia69%
Rattus norvegicusRatMammalia43%

This conservation pattern suggests that TMEM8A plays an important biological role that has been maintained throughout mammalian evolution, with higher conservation among primates .

What is the relationship between TMEM8A and other TMEM8 family proteins?

TMEM8A belongs to the TMEM8 protein family, which includes TMEM8A (PGAP6), TMEM8B, and TMEM8C (myomaker). These proteins share a common domain organization but have distinct functions .

Key comparisons:

Interestingly, unlike TMEM8A/myomaker which has a well-characterized role in muscle cell fusion, neither TMEM8A nor TMEM8B exhibit fusogenic activity despite structural similarities .

How does TMEM8A expression differ between humans and other species?

The expression profile of TMEM8A shows remarkable species-specific differences, which likely reflect its adapted functions:

In humans:

  • Preferentially expressed in resting T-lymphocytes

  • Highly expressed in placenta, pancreas, and lymphocytes

  • Not significantly expressed in erythroblasts

  • Not upregulated during terminal differentiation of human K562 erythroleukemia cells

In chickens:

  • Preferentially expressed in erythroid cells rather than lymphocytes

  • Expression levels at least 350 times higher in whole blood than in other tissues examined

  • Upregulated approximately five-fold upon terminal differentiation of erythroblasts

  • Transcribed more intensively in proliferating HD3 cells (chicken erythroblasts) than in CEF (chicken embryo fibroblasts) and much more than in DT40 cells (chicken lymphoid cells)

These differences likely arose after the relocation of TMEM8A to the vicinity of the α-globin gene cluster in chickens, which brought it under the control of erythroid-specific regulatory elements .

What techniques are most effective for analyzing TMEM8A expression patterns?

Several complementary techniques have proven effective for analyzing TMEM8A expression:

  • Real-time RT-PCR with TaqMan probes: This method allows quantitative detection of both intronic and exonic regions, enabling researchers to distinguish between actively transcribed genes (intronic detection) and steady-state mRNA levels (exonic detection) . This approach successfully identified differential expression of TMEM8A between erythroid and non-erythroid cells.

  • Northern blot analysis of poly A+ RNA: This technique identified a single band of ~5 kb representing TMEM8A mRNA, with intensity differences reflective of expression levels between proliferating and differentiated cells .

  • PCR amplification of RT products: Using primers designed to span multiple exons can confirm proper splicing of the TMEM8A transcript .

  • Flow cytometry: Anti-TMEM8A monoclonal antibodies can detect surface expression on intact cells, as demonstrated with human embryonic carcinoma NTERA2 cells and HEK293T cells .

  • Quantitative analysis of tissue samples: For comparing expression across multiple tissues, normalizing TMEM8A expression to housekeeping genes like β-actin provides reliable relative quantification .

  • DNA methylation analysis: Recent studies have identified differential methylation of TMEM8A in certain cell types, suggesting epigenetic regulation of expression that can be measured using techniques like RRBS (Reduced Representation Bisulfite Sequencing) .

How can researchers accurately track subcellular localization of TMEM8A?

Accurate tracking of TMEM8A's subcellular localization requires multiple complementary approaches:

  • Subcellular fractionation combined with western blotting: This technique successfully demonstrated that the 120-kD form of TMEM8A localizes to the plasma membrane while the 90-kD form is found in the ER .

  • Glycosylation analysis using specific glycosidases:

    • PNGase F treatment: Cleaves all N-linked glycans and can help identify glycosylated forms

    • EndoH treatment: Cleaves only high-mannose, immature glycans; the 120-kD band of TMEM8A is EndoH-resistant (mature) while the 90-kD band is EndoH-sensitive (immature)

  • Epitope tagging and immunofluorescence microscopy: HA-tagged TMEM8A was successfully detected on the cell surface using anti-HA antibodies .

  • Flow cytometry with surface staining: Non-tagged TMEM8A was detected on the cell surface using specific antibodies, confirming plasma membrane localization .

  • Comparative microscopic observation: Combined with fractionation data, this approach confirmed the dual localization pattern of TMEM8A in both the ER and plasma membrane .

Researchers should employ multiple methods when studying TMEM8A localization to distinguish between mature (plasma membrane) and immature (ER) forms of the protein.

What experimental approaches reveal TMEM8A's role in GPI-anchored protein processing?

TMEM8A (PGAP6) functions as a GPI-specific phospholipase A2 involved in the processing of GPI-anchored proteins (GPI-APs). The following experimental approaches have effectively characterized this function:

  • Overexpression studies in mammalian cell lines: Expressing HA-tagged TMEM8A in CHO 3B2A cells demonstrated its effect on reducing the levels of GPI-APs such as CD59 and decay-accelerating factor (DAF), while having minimal effect on other GPI-APs like uPAR .

  • Domain mapping through chimeric proteins: Creating chimeras between TMEM8A and related proteins (like TMEM8B) helped identify which domains are critical for GPI-specific PLA2 activity. For example, a chimera consisting of the N and EGF domains of PGAP6/TMEM8A and the seven TM domains of TMEM8B (AnBc) retained CRIPTO-releasing activity comparable to full-length PGAP6, indicating that the catalytic function resides in the transmembrane domains .

  • Substrate specificity assays: Testing TMEM8A activity against different GPI-APs revealed that it has narrow substrate specificity, affecting some GPI-APs (CD59, DAF) more than others (uPAR) .

  • Flow cytometry analysis: Measuring cell surface levels of GPI-APs in the presence or absence of TMEM8A/PGAP6 expression can quantitatively assess its processing activity .

  • Enzymatic characterization: Testing TMEM8A/PGAP6 for PLA2 activity specifically toward GPI anchors rather than other phospholipids confirms its specificity as a GPI-specific PLA2 .

These approaches collectively established TMEM8A/PGAP6 as a GPI-specific phospholipase A2 that functions on the cell surface to modulate the levels of specific GPI-anchored proteins.

What are the optimal methods for producing recombinant TMEM8A for functional studies?

Based on available information about TMEM8A and similar transmembrane proteins, the following methods are recommended for producing functional recombinant TMEM8A:

  • Expression systems:

    • Wheat germ cell-free system: Successfully used to produce recombinant human RAB8A, this system may be suitable for TMEM8A as it allows proper folding of complex proteins with multiple transmembrane domains .

    • Mammalian expression systems: Given TMEM8A's complex structure with multiple transmembrane domains and glycosylation, mammalian cell lines like HEK293T or CHO cells are appropriate for functional studies .

  • Protein tagging strategies:

    • N-terminal tagging: Using HA-tagged TMEM8A has been successful, particularly when including an appropriate signal sequence for ER insertion .

    • C-terminal tagging: May be used as an alternative, though care must be taken to ensure the tag doesn't interfere with the catalytic domains in the transmembrane regions.

  • Purification approaches:

    • Detergent solubilization with mild detergents to maintain native conformation

    • Affinity purification using tag-based systems (His-tag, FLAG-tag, etc.)

    • Size exclusion chromatography to separate properly folded protein from aggregates

  • Verification of functionality:

    • Assessing glycosylation status using EndoH and PNGase F treatments

    • Testing PLA2 activity against GPI-anchored substrates

    • Confirming proper folding through limited proteolysis or circular dichroism

  • Storage and stability:

    • Addition of stabilizing agents (glycerol, specific lipids)

    • Storage at appropriate temperatures to maintain enzymatic activity

    • Avoiding repeated freeze-thaw cycles

When designing expression constructs, researchers should consider that full-length TMEM8B was not stably expressed after transfection into several mammalian cell lines , suggesting that optimizations may be necessary for stable expression of TMEM8 family proteins.

How can researchers effectively study TMEM8A phosphorylation?

While the search results don't specifically address TMEM8A phosphorylation, they do discuss phosphorylation analysis of another RNA-binding protein (RBM8A) . Based on these methodologies and general phosphoprotein analysis techniques, the following approaches would be effective for studying TMEM8A phosphorylation:

  • Phos-tag gel analysis: This modified SDS-PAGE technique enables detection of phosphorylated proteins through mobility shift detection. The phosphorylated forms migrate more slowly than non-phosphorylated forms, allowing clear visualization of different phosphorylation states .

  • Phosphorylation site mutagenesis: Creating serine/threonine/tyrosine to alanine mutations at predicted phosphorylation sites can help identify critical phosphorylation sites that affect TMEM8A function .

  • Kinase inhibitor studies: Treatment with specific kinase inhibitors can help identify which kinases are responsible for TMEM8A phosphorylation.

  • Cell cycle synchronization: If phosphorylation is cell cycle-dependent, researchers can prepare cells in different cell cycle phases (G1/S, S, G2/M) using techniques like double thymidine blockage to analyze phosphorylation status at various stages .

  • Subcellular fractionation combined with phosphorylation analysis: This approach can determine whether phosphorylation status differs between TMEM8A localized in different cellular compartments (plasma membrane vs. ER) .

  • Phospho-specific antibodies: Development of antibodies specific to phosphorylated forms of TMEM8A would enable direct detection of phosphorylated protein by western blotting, immunoprecipitation, and immunofluorescence.

  • Mass spectrometry analysis: Phosphoproteomic analysis using liquid chromatography-tandem mass spectrometry (LC-MS/MS) can identify specific phosphorylation sites with high accuracy .

These techniques would provide comprehensive information about TMEM8A phosphorylation status, sites, and the functional consequences of phosphorylation on protein activity and localization.

How can researchers investigate TMEM8A's interaction with chromatin and gene regulation?

Given TMEM8A's proximity to the α-globin gene cluster in chickens and its involvement in gene expression changes, the following methods can be used to study its interaction with chromatin:

  • Chromosome Conformation Capture (3C) and derivatives:

    • Quantitative 3C analysis: This technique was successfully used to study how TMEM8A interacts with regulatory elements of the α-globin gene domain. It revealed that TMEM8A is not simply recruited to the α-globin gene domain active chromatin hub, but rather an alternative chromatin hub is assembled .

    • 4C, 5C, or Hi-C: These advanced 3C-based methods could provide more comprehensive analysis of TMEM8A chromatin interactions on a genome-wide scale.

  • Analysis of regulatory element interactions:

    • The −9 DHS (DNase I hypersensitive site) and the downstream enhancer of the α-globin gene domain were found to interact with TMEM8A .

    • Testing interactions with these elements using electrophoretic mobility shift assays (EMSA) or chromatin immunoprecipitation (ChIP) would provide further insights.

  • Chromatin hub assembly studies:

    • Analysis of how the "flip-flop" model applies to TMEM8A regulation, where the −9 DHS and downstream enhancer shuttle between two chromatin hubs .

    • Time-course analysis during cellular differentiation to determine when and how these interactions form.

  • DNase sensitivity profiles:

    • Domains of vertebrate α-globin genes belong to functionally determined gene domains located in gene-rich areas. Their profile of sensitivity to DNase I doesn't depend on cell lineage .

    • Mapping DNase sensitivity around the TMEM8A locus could reveal its chromatin environment.

  • Computational analysis of multispecies conserved sequences:

    • Interestingly, neither the −9 DHS nor the downstream enhancer of the chicken α-globin gene domain is present among previously identified multispecies conserved sequences, suggesting they are unique to chickens .

    • Comparative genomics approaches could identify other potential regulatory elements.

These approaches would help elucidate how TMEM8A interacts with chromatin regulatory elements and how these interactions contribute to its expression and function.

How can researchers resolve contradictory data regarding TMEM8A tissue expression?

Given the significant differences in TMEM8A expression between species and potential contradictions in reported expression patterns, researchers should employ the following approaches to resolve discrepancies:

  • Cross-validation with multiple detection methods:

    • Combine protein-level detection (western blot, immunohistochemistry) with mRNA-level analysis (RT-PCR, RNA-seq, northern blot)

    • Use both antibody-based and nucleic acid-based techniques to avoid method-specific artifacts

  • Careful selection of controls and normalization strategies:

    • Use multiple housekeeping genes for normalization rather than relying on a single reference gene

    • Include positive and negative control tissues with known expression levels

    • When comparing across species, use orthologous tissues at equivalent developmental stages

  • Distinguishing between active transcription and steady-state mRNA levels:

    • Analyze both intronic regions (indicating active transcription) and exonic regions (indicating mRNA levels)

    • Consider post-transcriptional regulation mechanisms that might affect mRNA stability

  • Cell type-specific analysis within tissues:

    • Use cell sorting techniques to isolate specific cell populations before expression analysis

    • For example, when analyzing TMEM8A in blood, separate erythrocytes from lymphocytes as was done in chicken studies

  • Developmental timing considerations:

    • Analyze expression at multiple developmental stages

    • Consider that even embryonic fibroblasts showed different TMEM8A expression compared to adult tissues in chickens

  • Epigenetic regulation analysis:

    • Investigate DNA methylation status of the TMEM8A locus, as differential methylation has been observed in some cell types

    • Analyze histone modifications and chromatin accessibility at the TMEM8A promoter

By systematically addressing these factors, researchers can reconcile seemingly contradictory expression data and develop a more nuanced understanding of TMEM8A expression patterns across tissues, developmental stages, and species.

What experimental designs would best elucidate TMEM8A's role in cellular stress responses?

Given the relationship between TMEM family proteins and cellular stress responses (as seen with TMEM208's role in ER stress ), the following experimental designs would effectively investigate TMEM8A's potential involvement in stress responses:

  • Loss-of-function approaches combined with stress induction:

    • CRISPR/Cas9-mediated knockout of TMEM8A followed by various stress inducers (ER stress, oxidative stress, etc.)

    • shRNA or siRNA knockdown with partial reduction of TMEM8A to study dose-dependent effects

    • Dominant-negative mutants targeting specific functional domains

  • ER stress marker analysis in TMEM8A-deficient systems:

    • Measure canonical ER stress markers similar to the TMEM208 study:

      • Bip/GRP78 protein levels (by western blot and immunostaining)

      • Phosphorylation of Eif2α

      • Xbp1 splicing using reporter constructs

  • Conditional expression systems to study temporal effects:

    • Inducible expression/repression systems (Tet-On/Off) to control TMEM8A levels at specific stages

    • Time-course analyses after stress induction to determine if TMEM8A is involved in early response or adaptation phases

  • Subcellular redistribution studies under stress conditions:

    • Track changes in TMEM8A localization between plasma membrane and ER during stress responses

    • Determine if stress affects the ratio between 120-kD (mature) and 90-kD (immature) forms

  • Identification of stress-dependent interaction partners:

    • BioID or APEX proximity labeling under normal versus stress conditions

    • Co-immunoprecipitation followed by mass spectrometry to identify stress-specific protein interactions

    • Yeast two-hybrid screening using TMEM8A domains as bait

  • GPI-AP processing under stress conditions:

    • Analyze how stress affects TMEM8A's phospholipase activity toward GPI-APs

    • Determine if specific GPI-APs are differentially processed during stress responses

  • Transcriptomic and proteomic profiling:

    • RNA-seq and proteomics analysis comparing TMEM8A-deficient and control cells under normal and stress conditions

    • Pathway analysis to identify which stress response pathways are affected by TMEM8A deficiency

These experimental approaches would provide comprehensive insights into TMEM8A's potential role in cellular stress responses, particularly in relation to ER stress and protein homeostasis.

What are the most promising approaches for investigating TMEM8A's role in cancer and disease progression?

Recent research has shown that altered expression of TMEM family proteins, such as TMEM158, correlates with cancer progression . For investigating TMEM8A's potential roles in disease, the following approaches are recommended:

  • Comprehensive expression analysis across cancer types:

    • Analyze TMEM8A expression across cancer databases (TCGA, ICGC, etc.)

    • Correlate expression with clinicopathological features as was done for TMEM158 :

      • Disease stage

      • Lymph node invasion

      • Patient age

      • Survival outcomes

      • Histological grade

  • Quantitative analysis with receiver operating characteristic (ROC) curves:

    • Evaluate TMEM8A's potential as a diagnostic or prognostic biomarker

    • Determine sensitivity and specificity for distinguishing malignant from benign tissues

  • Mechanistic studies in cancer cell models:

    • Overexpression and knockdown/knockout studies in relevant cancer cell lines

    • Analysis of effects on:

      • Proliferation and cell cycle progression

      • Migration and invasion capabilities

      • Response to chemotherapeutic agents

      • Anchorage-independent growth

  • Functional impact of disease-associated variants:

    • Identify naturally occurring variants in TMEM8A using genomic databases

    • Generate these variants through site-directed mutagenesis

    • Assess their impact on protein localization, stability, and enzymatic activity

  • GPI-AP processing in disease contexts:

    • Analyze how TMEM8A-mediated processing of GPI-APs like CD59 and DAF affects cancer cell properties

    • Investigate whether TMEM8A's phospholipase activity contributes to altered cell surface protein composition in cancer

  • Epigenetic regulation in disease states:

    • Analyze TMEM8A methylation status in various diseases, expanding on the differential methylation observed in certain cell types

    • Determine if epigenetic dysregulation contributes to altered TMEM8A expression in disease

  • Integration with immune response data:

    • Given TMEM8A's expression in resting T-lymphocytes in humans , investigate its potential role in immune evasion by cancer cells

    • Analyze correlations between TMEM8A expression and tumor-infiltrating lymphocyte (TIL) characteristics

These approaches would provide valuable insights into TMEM8A's potential roles in cancer and other diseases, possibly revealing new diagnostic biomarkers or therapeutic targets.

How can researchers effectively study the evolutionary adaptations of TMEM8A across species?

The striking difference in expression patterns between human and chicken TMEM8A provides a fascinating opportunity to study evolutionary adaptation. To effectively investigate this phenomenon, researchers should consider:

  • Comparative genomic analysis across diverse species:

    • Expand the analysis beyond mammals and birds to include reptiles, amphibians, and fish

    • Analyze synteny relationships to track genomic rearrangements like the inversion event in chickens

    • Create phylogenetic trees of TMEM8A sequences to identify accelerated evolution in specific lineages

  • Promoter and enhancer comparison studies:

    • Identify and compare TMEM8A regulatory regions across species

    • Use reporter assays to test functionality of species-specific regulatory elements

    • Determine if human TMEM8A would respond to chicken regulatory elements and vice versa

  • Chromatin interaction analysis in multiple species:

    • Apply 3C techniques across species to determine if TMEM8A forms similar or different chromatin hubs

    • Test if the "flip-flop" model of enhancer shuttling is conserved across species

  • Cross-species expression experiments:

    • Express chicken TMEM8A in human cells and vice versa

    • Determine if species-specific functions are intrinsic to the protein or dependent on cellular context

  • Molecular clock analysis:

    • Estimate when the genomic inversion occurred in the chicken lineage

    • Correlate this with other evolutionary events in avian development

  • Functional conservation testing:

    • Compare GPI-specific PLA2 activity of TMEM8A from different species

    • Test substrate specificity across species to determine if enzymatic function is conserved despite expression differences

  • Analysis of selective pressures:

    • Calculate dN/dS ratios to identify regions under positive or purifying selection

    • Determine if transmembrane domains with catalytic residues show different selection patterns than other regions

These approaches would provide insights into how TMEM8A adapted to different functions across evolutionary lineages and help understand the molecular basis for its species-specific expression patterns.

What collaborative research approaches would advance understanding of TMEM8A functions?

Given the multifaceted nature of TMEM8A biology, interdisciplinary collaborative approaches would significantly advance our understanding:

  • Integration of structural biology and enzymology:

    • Collaborate with structural biologists to determine the three-dimensional structure of TMEM8A

    • Partner with enzymologists to characterize its phospholipase activity against various substrates

    • Work with lipid biochemists to analyze how membrane composition affects TMEM8A function

  • Developmental biology and hematopoiesis experts:

    • Collaborate with developmental biologists to study TMEM8A's role during embryogenesis

    • Partner with hematopoiesis researchers to investigate its function in erythroid differentiation in chickens

    • Engage experts in T-cell biology to understand its role in human lymphocytes

  • Evolutionary biologists and comparative genomics specialists:

    • Work with evolutionary biologists to interpret the significance of TMEM8A's different expression patterns

    • Collaborate with comparative genomics experts to analyze regulatory element evolution

    • Partner with avian specialists to understand the functional significance of erythroid expression in birds

  • Systems biology and computational modeling:

    • Engage systems biologists to model TMEM8A within broader cellular networks

    • Develop computational models of chromatin hub dynamics based on the "flip-flop" model

    • Predict functional consequences of sequence variations across species

  • Clinical researchers and biobank collaborations:

    • Partner with clinical researchers to analyze TMEM8A expression in patient samples

    • Collaborate with biobanks to access diverse tissue collections for expression studies

    • Work with medical geneticists to identify potential disease-associated variants

  • Advanced imaging specialists:

    • Collaborate with super-resolution microscopy experts to visualize TMEM8A localization and dynamics

    • Partner with live cell imaging specialists to track TMEM8A movement between cellular compartments

    • Work with correlative light and electron microscopy experts to study TMEM8A at the ultrastructural level

  • Mass spectrometry and proteomics experts:

    • Collaborate to identify post-translational modifications of TMEM8A

    • Characterize TMEM8A interaction partners under different cellular conditions

    • Analyze the GPI-anchored proteome in the presence and absence of TMEM8A

These collaborative approaches would leverage diverse expertise to comprehensively understand TMEM8A biology from molecular mechanisms to physiological functions and evolutionary significance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.