Recombinant Human Transmembrane protein 8B (TMEM8B)

Fundamental Characteristics of Recombinant Human TMEM8B

Recombinant Human Transmembrane Protein 8B (TMEM8B) is a laboratory-synthesized version of the naturally occurring TMEM8B protein encoded by the TMEM8B gene in humans. The gene is also known by several alternative designations including C9orf127, NAG-5, NGX6, NAG5, FP588, NGX6a, and LINC00950 . The recombinant forms of this protein are designed to replicate the functional and structural properties of the natural protein while allowing for experimental manipulations, purification, and specific applications in research settings. Recombinant TMEM8B is particularly valuable for investigating cellular adhesion mechanisms, as the natural protein is involved in cell-matrix adhesion and is located at the cell surface and plasma membrane . The production of this protein in recombinant systems enables researchers to study its properties and functions in controlled laboratory environments.

The recombinant versions of Human TMEM8B typically include specific tags or modifications that facilitate purification, detection, and experimental applications. These modifications do not interfere with the protein's fundamental properties but enhance its utility in research contexts. By creating recombinant versions of TMEM8B, scientists can overcome the limitations associated with extracting the natural protein from human tissues, including low yield, contamination risks, and ethical considerations.

Genomic Context of TMEM8B

The TMEM8B gene, which serves as the template for recombinant production, is located on human chromosome 9 at position 9p13.3. This gene spans approximately 36,000 base pairs, starting at position 35,829,228 and ending at 35,865,515 on chromosome 9 . The gene contains 18 exons according to the most recent genomic annotations, though earlier data suggested 19 exons . This genomic architecture provides the foundation for creating recombinant constructs that accurately represent the native protein.

Transcript Variants and Isoforms

One of the challenges in producing recombinant TMEM8B is addressing the natural diversity of splice variants. The TMEM8B gene produces at least 13 different transcript variants, all protein-encoding, with varying amino acid lengths . This variation is important to consider when designing recombinant versions of the protein for specific research applications. The table below illustrates the diversity of TMEM8B isoforms that could potentially be produced as recombinant proteins:

This diversity presents both challenges and opportunities in recombinant protein production, as each isoform may possess unique functional characteristics relevant to different research questions .

Expression Systems

Several expression systems have been successfully employed to produce recombinant Human TMEM8B. Each system offers specific advantages depending on the intended application:

Wheat germ cell-free expression system has been used to produce recombinant Human TMEM8B (AA 1-257) with a GST tag . This eukaryotic cell-free system is particularly valuable for producing proteins that may be toxic to live cells or require post-translational modifications. The wheat germ system provides a controlled environment for protein synthesis and can produce proteins with proper folding.

Mammalian cell expression using HEK-293 cells has been employed to produce recombinant Human TMEM8B with His tags . This system offers the advantage of proper post-translational modifications and protein folding that closely resembles the native human protein. The HEK-293 cell system is particularly suitable for producing full-length transmembrane proteins like TMEM8B that require complex folding and membrane insertion.

Cell-free protein synthesis (CFPS) systems have also been used to produce recombinant Human TMEM8B with Strep tags . These systems allow for rapid protein production without the need for cell culture, offering advantages in terms of speed and scalability. The CFPS approach is particularly useful for producing proteins for initial screening or characterization studies.

Escherichia coli bacterial expression has been utilized to produce the Human TMEM8B (aa 1-80) Control Fragment recombinant protein . This system offers high yield and cost-effectiveness but may lack some post-translational modifications present in eukaryotic systems.

Purification and Quality Control

Recombinant Human TMEM8B proteins undergo rigorous purification and quality control processes to ensure their utility in research applications. The purification methods typically leverage the affinity tags (GST, His, or Strep) incorporated into the recombinant constructs . Quality assessment commonly includes SDS-PAGE with Coomassie blue staining, which typically confirms >80% purity for commercial preparations . For higher-end applications, additional quality controls such as Western blotting, mass spectrometry, and functional assays may be employed to verify the identity, integrity, and activity of the recombinant protein.

GST-Tagged Recombinant Human TMEM8B

A well-characterized recombinant form is the Human TMEM8B (AA 1-257) protein with a GST tag expressed in a wheat germ system . This recombinant protein contains the N-terminal portion of TMEM8B and includes the following amino acid sequence:

MWRPHFHTCP PQSSVRQENV TVFGCLTHEV PLSLGDAAVT CSKESLAGFL LSVSATTRVA RLRIPFPQTG TWFLALRSLC GVGPRFVRCR NATAEVRMRT FLSPCVDDCG PYGQCKLLRT HNYLYAACEC KAGWRGWGCT DSADALTYGF QLLSTLLLCL SNLMFLPPVV LAIRSRYVLE AAVYTFTMFF STVCGGVCIL SLGACAWWWV TVCISTTFSE GLGMSVPSLC LLQTETAVLP KLSCIDNGHF CKTHWSK

This protein is particularly suitable for applications in Western blotting, ELISA, antibody arrays, and affinity purification . The GST tag facilitates purification through glutathione affinity chromatography and can also enhance the solubility of the recombinant protein, which is especially valuable for transmembrane proteins that might otherwise form insoluble aggregates.

Control Fragment Recombinant Protein

Another significant recombinant product is the Human TMEM8B (aa 1-80) Control Fragment with a His-ABP tag . This fragment represents the N-terminal portion of the protein and has the following amino acid sequence:

MNMPQSLGNQPLPPEPPSLGTPAEGPGTTSPPEHCWPVRPTLRNELDTFSVHFYIFFGPSVALPPERPAVFAMRLLPVLD

This control fragment is particularly valuable for validating antibody specificity in immunological assays. It shows high sequence conservation with mouse and rat orthologs (90% identity), making it useful for cross-species comparisons . The recommended application is in blocking experiments with corresponding antibodies, where a 100x molar excess of the protein fragment control is typically used, pre-incubated with the antibody for 30 minutes at room temperature before the main experiment.

Biochemical Properties

Recombinant Human TMEM8B maintains the key functional domains present in the native protein. As a transmembrane protein, it contains hydrophobic domains that span the cell membrane, with portions exposed to both the extracellular and intracellular environments . The protein is naturally expressed as a glycoprotein on the cell surface, and some recombinant systems aim to preserve these post-translational modifications .

The protein is involved in cell-matrix adhesion processes, suggesting interactions with extracellular matrix components . Additionally, TMEM8B appears to play roles in cell signaling pathways, particularly those that regulate cell migration and intercellular communication . The ectopic induction of Epidermal Growth Factor (EGF) can impair nasopharyngeal carcinoma cell migration and improve cell adhesion and gap junctional intercellular communication through mechanisms involving TMEM8B .

Research Applications

Recombinant Human TMEM8B finds applications in numerous research areas:

Antibody validation: The control fragment recombinant protein is specifically designed for blocking experiments to validate the specificity of anti-TMEM8B antibodies . This application is crucial for ensuring the reliability of immunoassays targeting TMEM8B in both research and potential clinical settings.

Cancer research: Given that TMEM8B expression is downregulated in nasopharyngeal and colorectal carcinomas, recombinant TMEM8B proteins serve as valuable tools for investigating the protein's role in cancer progression . Research indicates that down-regulation of TMEM8B (C9orf127) may be closely associated with tumorigenesis and metastasis of colorectal carcinoma, although it appears not to significantly contribute to the development and progression of gastric carcinoma .

Cell adhesion studies: The involvement of TMEM8B in cell-matrix adhesion makes recombinant versions useful for studies investigating cellular attachment, migration, and related processes . These studies contribute to our understanding of fundamental cellular behaviors relevant to both normal physiology and pathological conditions.

Agricultural research: Interestingly, TMEM8B has been studied in relation to mature weight in sheep, with researchers examining how single nucleotide polymorphisms in this gene might affect growth parameters . This application demonstrates the broad relevance of TMEM8B across species and research disciplines.

Cross-Species Conservation

Recombinant Human TMEM8B has significant homology with orthologous proteins in other mammals. The Human TMEM8B (aa 1-80) Control Fragment shows 90% sequence identity with both mouse and rat orthologs, indicating strong evolutionary conservation of this protein . This high degree of conservation suggests fundamental biological importance and provides justification for using model organisms to study TMEM8B functions relevant to human biology.

The conservation extends beyond sequence similarity to functional roles, as TMEM8B appears to be involved in similar biological processes across species. In mouse models, TMEM8B has been associated with various biological systems including adipose tissue, cardiovascular system, nervous system, immune system, digestive system, and reproductive system . This broad impact across multiple physiological systems further underscores the protein's biological significance.

Evolutionary Implications

The high degree of conservation observed in TMEM8B across mammalian species suggests that this protein has been subject to strong evolutionary selection pressure. This conservation pattern typically indicates that the protein serves essential biological functions that have been maintained through evolutionary history. The production of recombinant versions of Human TMEM8B that can be compared with orthologs from other species facilitates comparative studies that can illuminate both the conserved and species-specific aspects of TMEM8B function.

Potential Therapeutic Applications

Given the association of TMEM8B with cancer progression, particularly its downregulation in certain carcinomas, recombinant TMEM8B may have potential applications in cancer diagnostics or therapeutics . Future research might explore whether recombinant TMEM8B or derivatives could serve as therapeutic agents for cancers characterized by TMEM8B downregulation.

The involvement of TMEM8B in cell adhesion processes also suggests potential applications in regenerative medicine, where modulating cell-matrix interactions is often crucial for tissue engineering and wound healing . As our understanding of TMEM8B functions continues to evolve, novel therapeutic applications may emerge.

Technological Advances

Ongoing advances in recombinant protein production technologies are likely to enhance the quality, yield, and functionality of recombinant Human TMEM8B preparations. Improvements in expression systems, purification methods, and protein engineering approaches may lead to recombinant TMEM8B variants with enhanced stability, solubility, or functional properties optimized for specific research or therapeutic applications.

The integration of recombinant TMEM8B with emerging technologies such as single-cell analysis, proteomics, and structural biology approaches will likely provide deeper insights into the protein's functions and mechanisms of action. These technological synergies may accelerate discoveries related to TMEM8B and broaden its applications in both basic research and translational medicine.