Recombinant Human Transmembrane protein 93 (TMEM93)

Shipped with Ice Packs
In Stock

Description

Overview of TMEM93

Transmembrane Protein 93 (TMEM93), also known as ER membrane protein complex subunit 6 (EMC6), is a conserved multi-pass transmembrane protein localized to the endoplasmic reticulum (ER). It is a core subunit of the ER membrane protein complex (EMC), which facilitates the biogenesis of multipass transmembrane proteins, particularly those with destabilizing features such as charged residues in transmembrane domains (TMDs) . Recombinant human TMEM93 is engineered for research applications, enabling studies on its structural, functional, and pathological roles.

Expression and Purification

Recombinant TMEM93 is produced in heterologous systems for functional studies:

  • Host systems:

    • E. coli: Cost-effective for bulk production but lacks post-translational modifications .

    • Insect cells: Used for crystallization-grade protein with proper folding .

  • Purification: Multi-step chromatography (e.g., affinity, SEC) achieves >85% purity .

Representative Recombinant TMEM93 Products

Catalog No.HostTagPurityApplicationsSource
YHK07202E. coliGST & C-His>90%ELISA, WB, Bioactivity AntibodySystem
ABIN3144343Insectrho-1D4Crystallization gradeCrys, WB Antibodies-Online
MBS7032022Cell-freeNone≥85%SDS-PAGE, ELISA MyBioSource

4.1. Membrane Protein Biogenesis

TMEM93/EMC6 is critical for cotranslational insertion of multipass transmembrane proteins into the ER. Key findings include:

  • Client specificity: Preferentially interacts with transporters and ion channels containing polar/charged TMD residues (e.g., solute carriers, GPCRs) .

  • Mechanism: Stabilizes nascent TMD clusters during translation, preventing aggregation and premature degradation .

4.2. Autophagy Regulation

  • TMEM93 deficiency disrupts autophagosome formation by impairing RAB5A and BECN1 interactions, leading to accumulation of autophagosomal precursors .

4.3. Pathological Associations

  • Retinal Degeneration: Emc6 knockout in mice causes rhodopsin mislocalization, photoreceptor cilia defects, and progressive vision loss .

  • Cancer: TMEM93 homologs (e.g., TMEM119, TMEM158) promote tumor migration via TGF-β/STAT3 pathways in osteosarcoma and gastric cancers .

Research Applications

Recombinant TMEM93 is used to study:

  • Protein-protein interactions: Co-immunoprecipitation with EMC subunits (e.g., EMC3, EMC5) .

  • Structural biology: Cryo-EM and crystallography to resolve EMC complex architecture .

  • Disease modeling: Retinal degeneration mechanisms in knockout mice .

Key Research Findings

Study FocusMethodologyOutcomeSource
EMC client specificityProximity-specific ribosome profilingEMC6 engages multipass clients after charged TMD clusters
Retinal functionEmc6 RKO/CKO miceTMEM93 deficiency disrupts rhodopsin trafficking and cilia integrity
Cancer progressionsiRNA knockdownTMEM119/158 silencing inhibits metastasis via TGF-β/STAT3

Challenges and Future Directions

  • Functional redundancy: Overlap with other EMC subunits (e.g., EMC3) complicates mechanistic studies .

  • Therapeutic targeting: EMC inhibition may sensitize cancer cells to chemotherapy but requires tissue-specific evaluation .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery timelines.
Please note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
EMC6; TMEM93; ER membrane protein complex subunit 6; Transmembrane protein 93
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-110
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
EMC6
Target Protein Sequence
MAAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYGFIFYLLASV LLSLLLILKAGRRWNKYFKSRRPLFTGGLIGGLFTYVLFWTFLYGMVHVY
Uniprot No.

Target Background

Function
Transmembrane protein 93 (TMEM93) is a component of the endoplasmic reticulum membrane protein complex (EMC), facilitating the energy-independent insertion of newly synthesized membrane proteins into the endoplasmic reticulum (ER). It preferentially accommodates proteins with weakly hydrophobic transmembrane domains or those containing destabilizing features such as charged and aromatic residues. TMEM93 plays a crucial role in the cotranslational insertion of multi-pass membrane proteins, where stop-transfer membrane-anchor sequences become ER membrane-spanning helices. It is also essential for the post-translational insertion of tail-anchored (TA) proteins into ER membranes. By mediating the proper cotranslational insertion of N-terminal transmembrane domains in an N-exo topology, with the translocated N-terminus in the lumen of the ER, TMEM93 regulates the topology of multi-pass membrane proteins like G protein-coupled receptors. Through its regulation of protein insertion into membranes, TMEM93 indirectly influences numerous cellular processes.
Gene References Into Functions
  1. The expression level of EMC-6 is significantly elevated in cervical cancer, without significant correlation with Beclin1 and Rab5a. PMID: 28742203
  2. This is the first study demonstrating that EMC6 induces cell death in gastric cancer cells. The molecular mechanism underlying EMC6's tumor suppressor function requires further investigation. PMID: 28648145
  3. Endoplasmic membrane protein complex subunit 6 (EMC6) interacts with both RAB5A and BECN1/Beclin 1 and colocalizes with the omegasome marker ZFYVE1/DFCP1. PMID: 23182941
Database Links

HGNC: 28430

KEGG: hsa:83460

STRING: 9606.ENSP00000248378

UniGene: Hs.30011

Protein Families
EMC6 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is TMEM93/EMC6 and what is its primary function?

TMEM93/EMC6 is an integral component of the endoplasmic reticulum membrane protein complex (EMC) that plays a crucial role in the energy-independent insertion of newly synthesized membrane proteins into endoplasmic reticulum membranes . Initially predicted to contain two transmembrane domains based on hydrophobicity profiles, more recent structural analysis using advanced modeling techniques suggests EMC6 actually forms a three-helix bundle .

The EMC complex as a whole functions as a membrane protein insertase and chaperone, with EMC6 contributing to the complex's ability to facilitate proper folding and insertion of various client proteins. While early topology prediction algorithms suggested two transmembrane domains, protease-protection assays and advanced structural predictions have resolved this discrepancy in favor of a three-transmembrane domain model .

How is TMEM93/EMC6 structurally organized within the EMC complex?

TMEM93/EMC6 exists as part of a multi-subunit membrane protein complex. Cryo-electron microscopy studies have revealed the structural organization of the EMC and positioned EMC6 within the transmembrane region of the complex . The architecture shows EMC6 forming interactions with other transmembrane subunits including EMC3 and EMC5, as determined through docking of predicted structures into EM density maps .

Within the complex, EMC6 contributes to the transmembrane region that creates a potential path for membrane protein insertion. Structural analysis at 6.4 Å resolution shows EMC6 positioned relative to the membrane plane with its helices arranged to potentially facilitate substrate handling during the insertion process .

What experimental methods are suitable for detecting TMEM93/EMC6 expression?

TMEM93/EMC6 can be effectively detected through several established techniques:

  • Immunohistochemistry (IHC-P): Commercial antibodies such as rabbit polyclonal antibodies against human EMC6 have been validated for paraffin-embedded tissue sections .

  • Immunocytochemistry/Immunofluorescence (ICC/IF): Antibodies targeting the N-terminal region (aa 1-50) have been shown to work effectively for cellular localization studies .

  • Western Blotting: This technique allows for quantitative analysis of EMC6 expression levels, particularly useful when evaluating overexpression or knockdown experiments .

  • Fluorescence-detection size-exclusion chromatography (FSEC): For recombinant studies, FSEC is valuable for assessing expression and monodispersity of tagged EMC6 constructs .

When selecting detection methods, researchers should consider the specificity of available antibodies and the potential cross-reactivity with other EMC components.

What role does TMEM93/EMC6 play in cancer biology, particularly in glioblastoma?

TMEM93/EMC6 has demonstrated significant tumor-suppressive properties in glioblastoma multiforme (GBM), one of the most aggressive forms of brain cancer. Experimental evidence indicates that overexpression of EMC6 suppresses cell proliferation in multiple GBM cell lines . The mechanism appears to involve activation of autophagy pathways.

Particularly noteworthy is EMC6's interaction with temozolomide (TMZ), the standard chemotherapeutic agent for GBM. When EMC6 is overexpressed in combination with TMZ treatment, there is enhanced accumulation of LC3B-II (a marker of autophagy) compared to either intervention alone . Western blot analysis showed:

Treatment ConditionRelative LC3B-II Expression (normalized to control)
Control1.0
TMZ onlySignificantly elevated
EMC6 overexpressionSignificantly elevated
TMZ + EMC6Further elevated beyond single treatments

This synergistic effect suggests EMC6 may be a potential target for enhancing the efficacy of existing GBM treatments through autophagy modulation .

How can researchers effectively produce and purify recombinant TMEM93/EMC6?

Production of functional recombinant TMEM93/EMC6 requires careful consideration of expression systems and purification strategies:

  • Mammalian Expression System: HEK293S GnTI− cells have proven effective for membrane protein expression, including EMC components. The BacMam expression system utilizing a modified pEG BacMam vector has shown superior results for complex membrane proteins .

Protocol Outline for BacMam-based Expression:

a) Clone the TMEM93/EMC6 gene into pEG BacMam vector with appropriate tags (GFP tag is recommended for initial screening)
b) Screen constructs via small-scale transient transfection in adherent cells (~1×10^6 HEK293S GnTI− cells in 2 ml medium)
c) Evaluate expression using fluorescence-detection size-exclusion chromatography (FSEC)
d) For larger-scale production, generate bacmid DNA by transforming DH10Bac E. coli with the validated construct
e) Transfect Sf9 cells with bacmid to produce P1 virus
f) Amplify to P2 virus and determine viral titer
g) Transduce suspension HEK293S GnTI− cells with optimized BacMam virus

This approach typically yields sufficient quantities of properly folded protein for structural and functional studies .

What is the relationship between TMEM93/EMC6 and cellular protein quality control pathways?

TMEM93/EMC6 plays a significant role in protein quality control through its participation in the EMC complex. Research has demonstrated that EMC6 overexpression enhances autophagy, a major cellular degradation pathway . This connection to autophagy has important implications for both normal cellular homeostasis and disease states.

In GBM cell lines, EMC6 overexpression substantially elevates LC3B-II levels, indicating increased autophagosome formation . This autophagy activation appears mechanistically linked to EMC6's anti-proliferative effects in cancer cells. Furthermore, the enhancement of TMZ-induced autophagy by EMC6 overexpression suggests a potential role in modulating drug sensitivity through protein quality control pathways .

The EMC complex itself functions at the interface of protein folding and quality control, ensuring proper membrane protein biogenesis. When EMC function is compromised, certain client proteins may be degraded, demonstrating the complex's role in determining protein fate .

How does TMEM93/EMC6 contribute to membrane protein insertion?

TMEM93/EMC6 functions as an integral component of the EMC insertase machinery. Structural and functional studies have revealed several key aspects of its contribution:

High-resolution cryo-EM studies (6.4 Å) have helped position EMC6 within the context of the complete EMC structure, showing its relationship to the membrane plane and other complex components . This structural information provides mechanistic insights into how EMC6 participates in the insertion process.

What experimental approaches can assess TMEM93/EMC6 interactions with client proteins?

Several sophisticated techniques have proven effective for studying EMC6-client interactions:

  • Photo-crosslinking assays: Using benzoyl-phenylalanine (Bpa) or 3'-azibutyl-N-carbamoyl-lysine (AbK) incorporated into potential client proteins to capture transient interactions with EMC components . This approach can identify specific interaction interfaces.

  • In vitro translation systems: The PURE system combined with photo-crosslinking has been used to study EMC interactions with transmembrane domains. This approach allows for controlled release of nascent chains from chaperones like calmodulin (CaM) to monitor subsequent interactions with EMC components .

  • Fluorescence-based assays: Monitoring client protein aggregation or protection in the presence or absence of functional EMC6 can provide quantitative measures of chaperone activity .

  • Multi-angle light scattering (MALS): When combined with size-exclusion chromatography (SEC-MALS), this technique can analyze complex formation between EMC6 and other components or potential client proteins .

For client identification, systematic analysis comparing protein levels in wild-type versus EMC6-depleted cells can identify potential EMC-dependent membrane proteins, though care must be taken to distinguish direct from indirect clients .

What are the key considerations for designing EMC6 overexpression studies?

When designing experiments to study the effects of EMC6 overexpression, researchers should consider:

  • Vector selection: For mammalian expression, the pEG BacMam vector has demonstrated superior results for membrane proteins . For transient experiments, vectors with strong CMV promoters, synthetic introns, and WPRE motifs enhance expression .

  • Cell line selection: HEK293S GnTI− cells are preferred for structural studies due to limited glycosylation, while standard HEK293 lines may be suitable for functional studies . For cancer studies, relevant disease models such as U87 glioblastoma cells have been validated .

  • Expression verification: Western blotting should be employed to confirm successful overexpression, using validated antibodies against EMC6 or epitope tags .

  • Controls: Appropriate empty vector controls are essential, and in some cases, overexpression of other EMC components may serve as specificity controls .

  • Functional readouts: For autophagy studies, LC3B-II levels should be monitored by western blotting. For proliferation effects, multiple complementary assays (e.g., MTT, colony formation) provide robust verification .

How can researchers effectively analyze EMC6 structure-function relationships?

To investigate structure-function relationships of EMC6:

  • Mutagenesis strategy:

    • Target conserved residues identified through sequence alignment across species

    • Focus on the three transmembrane helices that form EMC6's core structure

    • Create systematic alanine scanning mutations through transmembrane regions

    • Generate chimeric constructs with related proteins to identify functional domains

  • Functional complementation assays:

    • Use EMC6 knockout cell lines to test the ability of mutant constructs to rescue phenotypes

    • Measure client protein biogenesis as a functional readout

  • Interaction analysis:

    • Apply photo-crosslinking with strategically placed crosslinkers to map interaction interfaces

    • Use pulldown assays with tagged constructs to assess complex formation

  • Structural impact assessment:

    • Employ fluorescence-detection size-exclusion chromatography (FSEC) to evaluate the impact of mutations on EMC complex assembly

    • Use protease protection assays to verify topology of mutant constructs

What troubleshooting strategies are effective when working with recombinant TMEM93/EMC6?

Researchers working with recombinant TMEM93/EMC6 may encounter several challenges. Here are strategic approaches to address common issues:

ChallengeTroubleshooting Approach
Poor expression levels- Optimize codon usage for expression system
- Test different signal sequences and tags
- Adjust incubation temperature (typically 37°C with 5% CO₂)
- Add sodium butyrate (10 mM) to enhance expression
Protein aggregation- Screen multiple detergents for extraction
- Use FSEC to assess monodispersity before scaling up
- Consider adding stabilizing lipids during purification
Low functional activity- Verify complete complex formation with other EMC components
- Ensure proper post-translational modifications by using appropriate cell lines
- Test functionality in membrane mimetics beyond detergent micelles
Inconsistent results across experiments- Standardize virus titers using quantitative methods like Virus Counter 2100
- Maintain consistent cell density and passage number
- Implement rigorous quality control for purified components

For BacMam expression systems specifically, monitoring GFP fluorescence can provide real-time feedback on expression efficiency, and adjusting the virus-to-cell ratio can help optimize yield .

What are the emerging research areas for TMEM93/EMC6 beyond its canonical functions?

While TMEM93/EMC6's role in the EMC complex is well-established, several promising research avenues are emerging:

  • Therapeutic targeting in cancer: Given EMC6's suppressive effect on glioblastoma proliferation and its enhancement of TMZ efficacy, developing approaches to modulate EMC6 activity could have therapeutic potential . Research should focus on identifying small molecules that can enhance EMC6 expression or activity.

  • Role in neurodegenerative diseases: Given the importance of protein quality control in neurodegeneration, and EMC's role in membrane protein biogenesis, investigating EMC6's function in models of neurodegenerative diseases represents an important frontier.

  • Interaction with other cellular pathways: The connection between EMC6, autophagy, and cellular stress responses warrants deeper investigation, particularly regarding how EMC6 might influence cellular adaptation to different stressors .

  • Substrate-specific functions: While EMC is known to handle various client proteins, the potential specialized role of EMC6 in recognizing or processing specific substrate classes remains to be fully explored .

  • Structural dynamics: Advanced techniques like cryo-electron microscopy and molecular dynamics simulations could reveal how EMC6 contributes to the conformational changes necessary for substrate handling .

How can advanced imaging techniques enhance our understanding of TMEM93/EMC6 biology?

Advanced imaging approaches offer powerful tools for investigating EMC6 function:

  • Super-resolution microscopy: Techniques like STORM or PALM can visualize EMC6 distribution and dynamics within the ER membrane at nanoscale resolution, providing insights into its spatial organization relative to client proteins.

  • Live-cell imaging: Using fluorescently tagged EMC6 in conjunction with client proteins can reveal the dynamics of interactions during membrane protein biogenesis.

  • Correlative light and electron microscopy (CLEM): This approach can connect EMC6 function to ultrastructural features of the ER membrane.

  • FRET-based sensors: Developing FRET pairs between EMC6 and client proteins could provide real-time readouts of interaction dynamics in living cells.

  • Cryo-electron tomography: This technique could reveal the native organization of EMC complexes within cellular membranes, complementing existing structural data from purified complexes .

These advanced imaging approaches, coupled with the molecular and biochemical techniques described earlier, will provide a more comprehensive understanding of TMEM93/EMC6's roles in health and disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.