Recombinant Human Transmembrane protein 9B (TMEM9B)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TMEM9B; C11orf15; UNQ712/PRO1375; Transmembrane protein 9B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
34-198
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
TMEM9B
Target Protein Sequence
AKNFEDVRCKCICPPYKENSGHIYNKNISQKDCDCLHVVEPMPVRGPDVEAYCLRCECKY EERSSVTIKVTIIIYLSILGLLLLYMVYLTLVEPILKRRLFGHAQLIQSDDDIGDHQPFA NAHDVLARSRSRANVLNKVEYAQQRWKLQVQEQRKSVFDRHVVLS
Uniprot No.

Target Background

Function
TMEM9B enhances the production of pro-inflammatory cytokines induced by TNF, IL-1β, and TLR ligands. It plays a role in TNF activation of both the NF-κB and MAPK pathways.
Gene References Into Functions
  1. TMEM9B was identified as a potential antigenic target in Wegener's granulomatosis. PMID: 20951001
Database Links

HGNC: 1168

KEGG: hsa:56674

STRING: 9606.ENSP00000433361

UniGene: Hs.501853

Protein Families
TMEM9 family
Subcellular Location
Lysosome membrane; Single-pass membrane protein. Early endosome membrane; Single-pass membrane protein.

Q&A

Basic Research Questions

  • What is Transmembrane Protein 9B (TMEM9B) and what are its key structural characteristics?

TMEM9B is a glycosylated type I transmembrane protein with a cleavable signal peptide, featuring an extracellular N-terminus and intracellular C-terminus. According to AlphaFold predictions, it has a specific structural conformation that enables interactions with endosomal proteins .

Methodological approaches for structural characterization:

  • Employ bioinformatic resources such as AlphaFold for structural prediction

  • Conduct glycosylation site analysis to identify post-translational modifications

  • Use site-directed mutagenesis to determine functional domains

  • Implement fluorescent protein tagging at either terminus to confirm membrane orientation

  • Where is Transmembrane Protein 9B (TMEM9B) primarily localized in cells?

TMEM9B predominantly localizes to lysosomal membranes with partial distribution in early endosomes . This strategic positioning is crucial for its regulatory functions in endosomal/lysosomal compartments.

Recommended localization analysis methods:

  • Perform confocal microscopy with co-localization studies using organelle-specific markers

  • Conduct subcellular fractionation followed by immunoblotting

  • Utilize immunogold electron microscopy for high-resolution localization

  • Implement live-cell imaging with fluorescently tagged TMEM9B to track dynamic localization patterns

  • What are the main biological functions of Transmembrane Protein 9B (TMEM9B)?

TMEM9B serves multiple critical biological functions:

  • Regulates endosomal chloride/proton antiporters (ClC-3 and ClC-4)

  • Modulates inflammatory signaling pathways, particularly TNF, IL-1β, and TLR signaling

  • Acts downstream of RIP1 and upstream of MAPK and IκB kinases at the TAK1 complex level

  • Influences endosomal homeostasis, potentially affecting neuronal function

For functional analysis, researchers should:

  • Design gene silencing experiments (siRNA, CRISPR-Cas9) to assess loss-of-function effects

  • Perform overexpression studies to identify gain-of-function phenotypes

  • Analyze pathway components through phosphorylation status assessment

  • Measure cytokine production in response to TMEM9B manipulation

Advanced Research Questions

  • How does Transmembrane Protein 9B (TMEM9B) interact with CLC transporters, and what methodologies best detect these interactions?

TMEM9B specifically and strongly interacts with endosomal ClC-3 and ClC-4 transporters, while showing minimal interaction with lysosomal ClC-7 or muscle chloride channel ClC-1 .

CLC TransporterInteraction StrengthFunctional Effect of TMEM9B Co-expression
ClC-3StrongDramatic reduction in activity; slowed activation kinetics
ClC-4StrongDramatic reduction in activity
ClC-7MinimalCurrents hardly affected
ClC-1WeakCurrents slightly reduced

For studying these interactions, researchers should implement:

  • Förster Resonance Energy Transfer (FRET) techniques:

    • FLIM-FRET provides direct evidence for protein-protein interactions

    • Analysis using specialized software (e.g., AnaVision)

    • Enables quantitative assessment of interaction strength

  • Co-immunoprecipitation assays:

    • Verify physical interactions in cell systems

    • Follow with mass spectrometry for unbiased interaction partner identification

    • Validate with reverse immunoprecipitation

  • Database mining:

    • Query protein interaction databases (e.g., BioGRID) for candidate interactors

    • Cross-reference with transcriptomic data to identify co-expressed proteins

  • What electrophysiological protocols effectively characterize Transmembrane Protein 9B (TMEM9B) effects on ion transport?

For rigorous electrophysiological characterization of TMEM9B's effects on CLC transporters, researchers should employ:

  • For ClC-3/ClC-4 current measurements:

    • Apply 19 pulses of 10 ms duration

    • Use voltage decrements of 10 mV from +170 mV to −10 mV

    • Maintain holding potential at −30 mV

    • Perform baseline subtraction and subtract currents from non-injected controls

    • Normalize to values obtained at 170 mV for respective wild-type without TMEM9B

  • For kinetic analysis:

    • From 0 mV holding potential, deliver 500 ms activating test pulses

    • Use voltage range between 140 mV to −80 mV

    • Apply progressive hyperpolarization in 20 mV decrements

    • Follow with constant −80 mV tail pulse

  • Technical considerations:

    • Implement P/N subtraction procedure to correct for capacitive and leak currents

    • Apply scaled-down measurement protocol (0.2×) for appropriate subtraction

    • Compare multiple independent injections/transfections (minimum 3-5)

    • Test at least 6 oocytes per construct for statistical validity

  • How does Transmembrane Protein 9B (TMEM9B) participate in inflammatory signaling pathways?

TMEM9B functions as a critical component in multiple inflammatory signaling cascades:

  • In TNF signaling pathway:

    • Essential for both NF-κB and MAPK pathway activation

    • Functions downstream of receptor-interacting protein 1 (RIP1)

    • Acts at the level of the TAK1 complex, upstream of MAPK and IκB kinases

  • In interleukin 1 beta (IL-1β) and Toll-like receptor (TLR) pathways:

    • Required for production of proinflammatory cytokines

    • Functions as a shared module between these pathways

    • Lysosomal/endosomal localization suggests compartmentalized regulation

Methodological approaches should include:

  • Gene silencing with siRNA or shRNA to assess necessity in signaling

  • Phosphorylation analysis of downstream effectors by immunoblotting

  • Cytokine measurement by ELISA or multiplex assays

  • NF-κB and MAPK reporter assays with wild-type and mutant TMEM9B

  • What is the expression pattern of Transmembrane Protein 9B (TMEM9B) across different cancer types and what are the clinical implications?

TMEM9B shows distinct expression patterns across cancer types with significant prognostic implications:

Cancer TypeExpression PatternSurvival ImpactPrimary Genetic Alteration
Adrenocortical Carcinoma (ACC)IncreasedWorse OS (P=0.0032), DFS (P=0.00029)Amplification
Cervical Squamous Cell Carcinoma (CESC)IncreasedWorse OS (P=0.025)Amplification
Kidney Chromophobe (KICH)IncreasedWorse OS (P=0.013)Not specified
Uveal Melanoma (UVM)IncreasedWorse OS (P=0.00015), DFS (P=0.011)Not specified
Kidney Renal Papillary Cell Carcinoma (KIRP)IncreasedWorse DFS (P=0.0099)Not specified
Lung Adenocarcinoma (LUAD)IncreasedWorse DFS (P=0.035)Not specified
Uterine Corpus Endometrial Carcinoma (UCEC)DecreasedWorse DFS (P=0.0026)Amplification (2.46%), Mutation (2.27%)
Breast Invasive Carcinoma (BRCA)VariableNot significantHighest alteration (7.56%), primarily Amplification

Research approaches should include:

  • Analysis of expression databases (TCGA, GTEx)

  • Correlation with tumor mutational burden (TMB) and microsatellite instability (MSI)

  • Functional validation in cancer cell lines

  • Investigation of TMEM9B as a potential biomarker for treatment response

  • How can researchers differentiate between Transmembrane Protein 9B (TMEM9B) and its antisense transcript TMEM9B-AS1?

Distinguishing between TMEM9B protein and its antisense long non-coding RNA (TMEM9B-AS1) requires specialized approaches:

  • Gene-specific targeting:

    • Design CRISPR-Cas9 constructs with strand specificity

    • Develop antisense oligonucleotides for selective knockdown

    • Create overexpression vectors containing only one transcript

  • Expression analysis:

    • Implement strand-specific RT-PCR protocols

    • Use RNA-seq with strand information preservation

    • Apply Northern blotting with strand-specific probes

  • Functional evaluation:

    • TMEM9B primarily affects CLC transporters and inflammatory pathways

    • TMEM9B-AS1 influences ribosomal biogenesis and MYC mRNA stability

    • Compare phenotypes following selective knockdown of each transcript

  • Molecular interaction studies:

    • For TMEM9B: Protein-protein interaction assays (co-IP, FRET)

    • For TMEM9B-AS1: RNA-protein interaction methods (RNA immunoprecipitation)

    • TMEM9B-AS1 specifically interacts with IGF2BP1 to stabilize MYC mRNA

  • What experimental approaches are recommended for investigating Transmembrane Protein 9B (TMEM9B) in skeletal muscle disorders?

Based on recent findings regarding TMEM9B-AS1 in skeletal muscle, researchers should consider:

  • Expression analysis in muscle biopsies:

    • Quantify both TMEM9B and TMEM9B-AS1 expression

    • Compare between healthy individuals and those with muscle disorders

    • Analyze expression changes during muscle differentiation

  • Functional studies in myoblast/myotube cultures:

    • Manipulate TMEM9B expression and assess impact on differentiation

    • Measure effects on endosomal function in muscle cells

    • Evaluate consequences for protein degradation pathways

  • Animal models:

    • Generate tissue-specific knockout/knockdown models

    • Assess muscle mass, function, and metabolism

    • Investigate potential connection to insulin signaling

  • Mechanistic investigations:

    • Examine relationship between TMEM9B and TMEM9B-AS1 in muscle context

    • Study impact on translational capacity through ribosomal biogenesis

    • Analyze inflammatory signaling in muscle tissue with altered TMEM9B expression

  • What techniques can be employed to study Transmembrane Protein 9B (TMEM9B) regulation of endosomal/lysosomal function?

For comprehensive analysis of TMEM9B's role in endosomal/lysosomal compartments:

  • Vesicular pH assessment:

    • Implement ratiometric imaging with pH-sensitive fluorescent proteins

    • Use LysoTracker/LysoSensor dyes with live-cell imaging

    • Measure pH-dependent enzyme activities in isolated vesicles

  • Endosomal chloride transport:

    • Direct measurement using chloride-sensitive fluorescent indicators

    • Electrophysiological recording of ClC-3/ClC-4 currents with/without TMEM9B

    • Analysis of endosomal/lysosomal chloride concentration using chloride-sensitive probes

  • Trafficking dynamics:

    • Live-cell imaging with fluorescently tagged endosomal markers

    • Pulse-chase experiments with endocytic cargo

    • Quantification of endosome-lysosome fusion events

  • Degradative capacity:

    • Protein turnover assays for endosomal/lysosomal substrates

    • Measurement of lysosomal enzyme activity

    • Assessment of autophagy flux in presence/absence of TMEM9B

  • How can researchers produce and purify recombinant Transmembrane Protein 9B (TMEM9B) for structural and functional studies?

For efficient production of recombinant TMEM9B:

  • Expression systems selection:

    • Mammalian cells (HEK293, CHO) for proper glycosylation

    • Insect cells (Sf9, High Five) for higher yield

    • Bacterial systems with solubilization tags for specific domains

  • Purification strategy:

    • Detergent screening for optimal solubilization

    • Affinity chromatography using epitope tags

    • Size exclusion chromatography for final purification

    • Consider nanodiscs or amphipols for maintaining native conformation

  • Quality control:

    • Circular dichroism to verify secondary structure

    • Mass spectrometry to confirm glycosylation status

    • Functional validation through binding assays with known partners

  • Application-specific considerations:

    • For structural studies: Consider lipid composition for reconstitution

    • For binding studies: Validate with multiple detection methods

    • For antibody production: Use properly folded protein or specific peptides

  • What are the best approaches for investigating the relationship between Transmembrane Protein 9B (TMEM9B) and tumor mutational burden/microsatellite instability?

To explore TMEM9B's connection with genomic instability markers:

  • Correlation analysis:

    • Compare TMEM9B expression with TMB and MSI across cancer types

    • Focus particularly on cancers showing significant correlations (HNSC, KIRC, ACC)

    • Analyze these relationships in patient cohorts and cell line panels

  • Mechanistic investigations:

    • Modulate TMEM9B expression and assess impact on DNA repair pathways

    • Evaluate microsatellite stability in cells with altered TMEM9B levels

    • Measure mutation rates in reporter systems following TMEM9B manipulation

  • Clinical relevance assessment:

    • Stratify patient groups by TMEM9B expression and TMB/MSI status

    • Analyze treatment response patterns, particularly to immunotherapy

    • Develop potential biomarker panels incorporating TMEM9B with TMB/MSI

  • Experimental systems:

    • Use isogenic cell lines with defined TMB/MSI status

    • Apply DNA damage agents and assess repair in TMEM9B-modified cells

    • Implement CRISPR screens to identify synthetic lethal interactions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.