Recombinant Human Transmembrane protein C10orf57 (C10orf57)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for custom preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline for your preparation.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TMEM254; C10orf57; Transmembrane protein 254
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-123
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMEM254
Target Protein Sequence
MATAAGATYFQRGSLFWFTVITLSFGYYTWVVFWPQSIPYQNLGPLGPFTQYLVDHHHTL LCNGYWLAWLIHVGESLYAIVLCKHKGITSGRAQLLWFLQTFFFGIASLTILIAYKRKRQ KQT
Uniprot No.

Target Background

Database Links

HGNC: 25804

KEGG: hsa:80195

STRING: 9606.ENSP00000361355

UniGene: Hs.169982

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Transmembrane Protein C10orf57 (TMEM254) and what are its key biological functions?

Transmembrane protein C10orf57, also known as TMEM254, is a protein-coding gene whose primary function relates to its role as an integral component of membrane structures. The protein is identified by UniProt ID Q8TBM7 (Human) and Entrez Gene ID 80195 (Human) . While the complete biological functions of TMEM254 remain under investigation, current research suggests potential involvement in cellular membrane processes. Gene Ontology (GO) annotations specifically highlight its role as an integral component of membrane structures, indicating its embedment within biological membranes rather than peripheral attachment .

Ongoing studies have begun investigating its potential associations with neurodevelopmental disorders and cancer pathways, suggesting broader functional significance than initially recognized . The protein's transmembrane nature indicates roles in cellular signaling, transport, or structural maintenance, though specific pathways continue to be characterized through experimental models.

How does TMEM254 protein expression vary across different human tissues?

Based on available research, TMEM254 shows variable expression patterns across human tissue types. When conducting tissue expression analysis, researchers typically employ Western blotting techniques with specific antibodies targeting TMEM254 epitopes. The recommended methodology involves tissue homogenization in appropriate lysis buffers containing protease inhibitors, followed by protein quantification and separation via SDS-PAGE .

Researchers investigating tissue-specific expression should consider:

  • Employing multiple antibodies targeting different epitopes of TMEM254 for validation

  • Including appropriate housekeeping protein controls for normalization

  • Complementing protein analysis with RNA-based expression profiling (qPCR or RNA-seq)

  • Correlating expression with tissue-specific markers

Expression patterns should be analyzed both at the RNA and protein levels to identify potential post-transcriptional regulation mechanisms that might be tissue-specific.

What are the recommended antibodies and validation methods for TMEM254 detection?

For reliable detection of TMEM254 in research applications, antibodies such as the polyclonal antibody PA5-65040 (with immunogen sequence: QSIPYQNLGPL GPFTQYLVDH HHTLLCNGYW LAWLIHVGES LYAIVLCKHK GITSGR) or the rabbit recombinant monoclonal antibody EPR14666 have demonstrated efficacy in Western blotting applications .

When validating antibodies for TMEM254 detection, researchers should implement the following methodology:

  • Perform specificity testing using:

    • Knockout/knockdown controls

    • Peptide competition assays

    • Cross-reactivity assessment with related proteins

  • Validate across multiple experimental techniques:

    • Western blotting (primary validation)

    • Immunohistochemistry/immunofluorescence (localization studies)

    • Immunoprecipitation (for interaction studies)

  • Technical validation parameters:

    • Signal-to-noise ratio determination

    • Linearity of detection assessment

    • Batch-to-batch consistency evaluation

Notably, the polyclonal antibody PA5-65040 shows cross-reactivity with orthologs including mouse (82% sequence identity) and rat (81% sequence identity), which may be advantageous for comparative studies across species .

How can researchers design experiments to investigate TMEM254's role in neurodevelopmental disorders?

Investigating TMEM254's role in neurodevelopmental disorders requires a carefully structured experimental approach incorporating multiple methodologies. Based on current understanding that suggests potential associations between C10orf57 (TMEM254) and neurodevelopmental conditions , researchers should design experiments that address both expression patterns and functional impacts.

A comprehensive experimental design should include:

  • Expression Analysis in Clinical Samples:

    • Compare TMEM254 expression levels in brain tissue or derived cells from affected individuals versus controls

    • Utilize RT-qPCR, Western blotting, and immunohistochemistry in parallel for validation

    • Include age-matched controls and appropriate reference genes/proteins

  • Genetic Association Studies:

    • Screen for mutations or variants in TMEM254 in patient cohorts

    • Perform whole-exome or targeted sequencing followed by variant calling

    • Conduct statistical analyses to determine significant associations

  • Functional Studies using Cellular Models:

    • Develop TMEM254 knockdown/knockout models in neuronal cell lines

    • Assess phenotypic changes including morphology, electrophysiology, and protein localization

    • Rescue experiments with wild-type and mutant forms of TMEM254

  • Animal Model Development:

    • Generate conditional knockout models with tissue-specific deletion in neural tissues

    • Assess developmental milestones, behavior, and neuroanatomy

    • Perform molecular and cellular analysis of affected tissues

When designing these experiments, researchers must control for confounding variables through randomization, blinding, and inclusion of multiple experimental units per treatment group . Statistical analysis should employ appropriate methods such as ANOVA, ANCOVA, or MANOVA depending on the experimental design and number of dependent variables .

What methodological approaches are recommended for studying TMEM254's potential role in cancer pathways?

To investigate TMEM254's potential involvement in cancer pathways, researchers should employ a systematic multi-level approach that incorporates both observational and interventional methodologies.

Research LevelMethodological ApproachKey TechniquesExpected Outcomes
Expression AnalysisComparative transcriptomics and proteomicsRNA-seq, Western blot, IHC, tissue microarraysExpression profiles across cancer types and stages
Genetic AlterationsMutation and copy number analysisTargeted sequencing, FISH, digital PCRFrequency and type of genetic alterations
Functional ImpactCell-based assays with gene modulationCRISPR/Cas9, shRNA, overexpression systemsEffects on proliferation, migration, apoptosis
Mechanism InvestigationProtein interaction studiesCo-IP, proximity labeling, ChIP-seqIdentification of binding partners and pathways
Clinical CorrelationPatient data integrationSurvival analysis, multivariate regressionPrognostic/predictive value assessment

For functional validation, researchers should employ both loss-of-function and gain-of-function approaches in multiple cancer cell lines representing different tissue origins. This experimental design should include appropriate controls and replication to ensure statistical validity .

Analysis of results should incorporate multivariate statistical methods to account for potential confounding variables in cancer studies, such as genetic background, tumor heterogeneity, and microenvironmental factors . When designing these experiments, researchers should consider employing a two-way ANOVA or MANOVA approach to simultaneously assess the effects of TMEM254 modulation across different cancer subtypes or treatment conditions .

How do post-translational modifications affect TMEM254 localization and function?

Investigating post-translational modifications (PTMs) of TMEM254 requires specialized techniques that can identify, localize, and functionally characterize these modifications. While specific PTMs of TMEM254 are not extensively documented in the provided search results, a methodological framework for their investigation would include:

  • PTM Identification Strategy:

    • Mass spectrometry-based proteomics using enrichment techniques for specific modifications (phosphorylation, glycosylation, ubiquitination)

    • Site-directed mutagenesis of predicted modification sites

    • Western blotting with modification-specific antibodies

  • Subcellular Localization Analysis:

    • Confocal microscopy with fluorescently tagged wild-type and PTM-mutant TMEM254

    • Subcellular fractionation followed by Western blotting

    • Live-cell imaging to track dynamic changes in localization

  • Functional Impact Assessment:

    • Compare activity of wild-type versus PTM-mutant proteins in relevant functional assays

    • Identify binding partners that recognize specific PTMs using proximity labeling techniques

    • Temporal analysis of PTM occurrence during cellular processes

Researchers should design these experiments with appropriate controls, including non-modifiable mutants and PTM-mimicking mutations where applicable. Statistical analysis of localization and functional data should employ methods capable of detecting subtle changes across multiple experimental conditions, such as multiple regression analysis or factor analysis .

What are the optimal conditions for expressing recombinant TMEM254 in different expression systems?

Optimizing recombinant TMEM254 expression requires careful consideration of expression systems based on the protein's transmembrane nature. The following methodological approach addresses key considerations for different expression platforms:

Expression SystemAdvantagesOptimization ParametersVerification Methods
Mammalian Cells (HEK293, CHO)Native-like membrane environment, PTMsTransfection method, cell density, expression duration, temperatureWestern blot, flow cytometry, microscopy
Insect Cells (Sf9, Hi5)Higher yield than mammalian, eukaryotic PTMsViral titer, MOI, harvest timing, temperatureWestern blot, membrane preparation yield
Bacterial Systems (E. coli)High yield, economicalCodon optimization, fusion tags, induction parameters, inclusion body processingSDS-PAGE, Western blot, functional assays
Cell-Free SystemsRapid, avoids toxicity issuesTemplate concentration, membrane mimetics, reaction componentsDirect measurement of protein synthesis

When optimizing expression conditions, researchers should implement a systematic approach:

  • Design an expression construct with:

    • Appropriate affinity/purification tags that won't interfere with transmembrane domains

    • Codon optimization for the host system

    • Inducible promoters for toxic protein control

  • Perform small-scale optimization by testing:

    • Multiple expression temperatures (reduced temperatures often improve folding)

    • Induction timing and duration

    • Additives that may stabilize membrane proteins (glycerol, specific detergents)

  • Validate proper folding and functionality through:

    • Circular dichroism to assess secondary structure

    • Size-exclusion chromatography to verify monodispersity

    • Functional assays specific to predicted activities

This experimental design should include multiple experimental units per condition with appropriate controls, including expression of a known transmembrane protein under identical conditions .

How should researchers design experiments to identify TMEM254 interaction partners?

Identifying interaction partners of TMEM254 requires experimental approaches tailored to membrane proteins. The following comprehensive strategy incorporates multiple complementary methods:

  • Proximity-Based Methods:

    • BioID or TurboID fusion with TMEM254 to biotinylate proximal proteins

    • APEX2 fusion for proximity labeling in living cells

    • Implementation requires:
      a) Creation of N- and C-terminal fusions to avoid disrupting transmembrane regions
      b) Verification of fusion protein localization
      c) Optimization of labeling conditions (biotin concentration, labeling time)

  • Affinity Purification Methods:

    • Co-immunoprecipitation with mild detergents to maintain membrane protein interactions

    • Tandem affinity purification with quantitative proteomics

    • Critical parameters include:
      a) Detergent selection tailored to maintain TMEM254 interactions
      b) Crosslinking optimization if appropriate
      c) Negative controls including isotype antibodies and competing peptides

  • Genetic/Functional Screening:

    • Yeast two-hybrid membrane system adaptations

    • CRISPR screens to identify functional interactions

    • Synthetic lethality/genetic interaction mapping

  • Computational Prediction and Validation:

    • In silico prediction of interaction partners based on structural models

    • Network analysis to identify high-confidence candidates

    • Targeted validation of predicted interactions

The experimental design should incorporate appropriate randomization and blinding where possible, with sufficient replication to ensure statistical power . Data analysis should employ statistical methods capable of distinguishing specific interactions from background, such as comparing spectral counts or intensity values to appropriate controls using t-tests or more advanced statistical models .

What controls and validation steps are essential when studying TMEM254 using CRISPR-Cas9 gene editing?

CRISPR-Cas9 gene editing of TMEM254 requires rigorous controls and validation to ensure specificity and accurate interpretation of results. The following methodological framework outlines essential considerations:

  • Guide RNA Design and Validation:

    • Design multiple gRNAs targeting different exons of TMEM254

    • In silico screening for off-target effects using algorithms like Cas-OFFinder

    • Empirical validation of gRNA efficiency using mismatch detection assays (T7E1, TIDE)

  • Essential Experimental Controls:

    • Non-targeting gRNA controls with identical delivery method

    • Rescue experiments using CRISPR-resistant TMEM254 variants

    • Isogenic cell line comparisons to account for clonal variation

  • Comprehensive Validation of Editing:

    • Genomic verification: Targeted sequencing of the TMEM254 locus

    • Transcript verification: RT-PCR and sequencing of TMEM254 mRNA

    • Protein verification: Western blotting with validated antibodies

    • Functional verification: Phenotypic assays relevant to predicted TMEM254 function

  • Off-Target Effect Assessment:

    • Targeted sequencing of predicted off-target sites

    • Whole-genome or whole-exome sequencing for comprehensive analysis

    • Rescue experiments to confirm phenotype specificity

  • Clone Selection and Characterization:

    • Analysis of multiple independent clones

    • Detailed characterization of each clone's editing pattern

    • Documentation of passage number and growth characteristics

Statistical analysis should include multiple clones per gRNA, appropriate biological replicates, and careful selection of statistical tests based on data distribution . Researchers should employ two-way ANOVA or similar approaches when comparing multiple clones across different experimental conditions to account for both clone-specific and treatment-specific effects .

How can researchers analyze TMEM254 expression data across different experimental conditions?

Analyzing TMEM254 expression across experimental conditions requires appropriate statistical approaches and controls to ensure accurate interpretation. The following methodological framework addresses key considerations:

  • Normalization Strategies for Expression Data:

    • For RT-qPCR: Employ multiple reference genes validated for stability across experimental conditions

    • For Western blotting: Use total protein normalization or multiple housekeeping proteins

    • For RNA-seq: Apply appropriate normalization methods (TPM, FPKM, or DESeq2 normalization)

  • Statistical Analysis Approach:

    • For comparing two conditions: Paired or unpaired t-tests based on experimental design

    • For multiple conditions: One-way or two-way ANOVA followed by appropriate post-hoc tests

    • For complex designs: ANCOVA to control for covariates or MANOVA for multiple dependent variables

  • Visualization Methods:

    • Create box plots or violin plots to show distribution of expression values

    • Use heat maps for multiple condition comparisons

    • Generate correlation plots to identify relationships with other genes/proteins

  • Advanced Analysis:

    • Implement time-series analysis for expression dynamics

    • Perform principal component analysis to identify major sources of variation

    • Apply machine learning algorithms to identify patterns across complex datasets

When analyzing expression data, researchers should be attentive to potential confounding variables, ensure appropriate replication (biological and technical), and apply statistical tests that align with the data distribution properties . For comprehensive analysis of TMEM254 expression across multiple conditions, researchers might consider factor analysis or multiple regression approaches to identify key variables influencing expression patterns .

What statistical approaches are recommended for analyzing phenotypic changes in TMEM254 knockout/knockdown models?

Analyzing phenotypic changes in TMEM254 knockout or knockdown models requires rigorous statistical approaches tailored to the specific experimental design and measured outcomes. The following framework provides methodological guidance:

  • Experimental Design Considerations:

    • Include multiple control groups: non-targeting siRNA/shRNA, wild-type cells, and rescue conditions

    • Implement sufficient biological replicates (minimum n=3, preferably n≥5)

    • Control for passage number and culture conditions

  • Statistical Analysis by Phenotype Category:

Phenotype CategoryMeasurement ApproachRecommended Statistical Method
Morphological ChangesQuantitative image analysist-tests (two conditions) or ANOVA (multiple conditions)
Proliferation/ViabilityGrowth curves, metabolic assaysRepeated measures ANOVA or mixed effects models
Gene Expression ChangesRNA-seq, qPCR arraysDESeq2, limma, or similar differential expression tools
Multiple Cellular ParametersHigh-content imagingMANOVA or MANCOVA for correlated outcomes
Temporal PhenotypesTime-series experimentsTime-series analysis, area under curve comparisons
  • Advanced Statistical Considerations:

    • Implement hierarchical or mixed models for nested experimental designs

    • Consider Bayesian approaches for complex datasets with prior knowledge

    • Apply multiple testing corrections (Bonferroni, FDR) when analyzing multiple parameters

    • Use regression models to identify relationships between knockdown efficiency and phenotype magnitude

  • Integration with Omics Data:

    • Correlate phenotypic outcomes with molecular profiles

    • Apply systems biology approaches to contextualize TMEM254 function

    • Perform pathway enrichment analysis on differentially expressed genes/proteins

Researchers should select statistical tests based on data distribution (parametric vs. non-parametric) and employ appropriate post-hoc tests following significant ANOVA results . For complex experimental designs with multiple factors, two-way ANOVA, MANOVA, or MANCOVA approaches may be necessary to properly account for all variables .

How should researchers interpret contradictory findings regarding TMEM254 function across different experimental systems?

When confronted with contradictory findings regarding TMEM254 function across different experimental systems, researchers should employ a systematic approach to reconcile discrepancies and identify underlying factors. The following methodological framework addresses this challenge:

  • Systematic Comparison of Experimental Variables:

    • Cell/Tissue Context Analysis:

      • Document cell types, tissues, and organisms used across studies

      • Analyze baseline expression patterns of TMEM254 and related genes

      • Consider developmental stage and differentiation status differences

    • Methodological Comparison:

      • Catalog knockout/knockdown approaches (CRISPR, RNAi, antisense)

      • Compare antibodies and detection methods used

      • Analyze assay sensitivity and specificity across studies

    • Experimental Conditions Assessment:

      • Document culture conditions, treatments, and timepoints

      • Consider potential stress responses or compensatory mechanisms

      • Evaluate experimental timeline differences (acute vs. chronic effects)

  • Statistical Meta-Analysis Approach:

    • Standardize effect sizes across studies when possible

    • Implement random-effects models to account for between-study heterogeneity

    • Perform subgroup analyses to identify factors associated with discrepant results

  • Validation Experiments to Resolve Contradictions:

    • Design experiments specifically addressing contradictory findings

    • Include multiple methodological approaches in parallel

    • Implement dose-response or time-course designs to capture dynamic effects

  • Theoretical Framework Development:

    • Formulate hypotheses that could explain seemingly contradictory findings

    • Consider context-dependent functions or regulatory mechanisms

    • Develop testable models incorporating conditional effects

When analyzing contradictory findings, researchers should consider employing multivariate statistical approaches such as principal component analysis or factor analysis to identify patterns across studies that might explain discrepancies . For complex datasets, hierarchical clustering or network analysis may help visualize relationships between experimental conditions and outcomes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.