Recombinant Human Transmembrane protein C19orf77 (C19orf77)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Overview

  • Gene Aliases: C19orf77, HSPC323, SMIM24 .

  • UniProt ID: O75264 (Human) .

  • Protein Structure:

    • Full-length protein: 130 amino acids .

    • Recombinant fragment (aa 52–99): 48 amino acids, molecular weight not explicitly stated .

    • Transmembrane domains: Predicted membrane localization .

PropertyDetails
Chromosomal Location19q13.2 (GRCh38.p14)
Sequence Homology (Mouse/Rat)44% identity to both species
Tissue ExpressionMembranous expression in small intestine, kidney, and epididymis

Recombinant Protein Use

Recombinant C19orf77 fragments (e.g., aa 52–99) are produced for antibody validation and blocking experiments. Key applications include:

  • Antibody Specificity Testing: Used as a control fragment for antibody PA5-60909 in Western blot (WB), immunohistochemistry (IHC), and immunocytochemistry (ICC) .

  • Experimental Protocols:

    • Molar Excess: 100× molar excess recommended for pre-adsorption with antibodies .

    • Incubation: 30 minutes at room temperature prior to assays .

Validated Antibodies

Multiple antibodies targeting SMIM24/C19orf77 are commercially available, including:

ProviderCatalog NumberTypeApplications
Atlas AntibodiesHPA045046PolyclonalIHC
InvitrogenPA5-65991PolyclonalICC, IHC
Novus BiologicalsNBP2-58735PolyclonalICC, IHC

Expression and Localization

  • Tissue Distribution: Highest membranous expression observed in the small intestine, kidney, and epididymis .

  • Cellular Role: Predicted involvement in membrane-associated processes, though specific mechanisms are not yet fully elucidated .

Research Contexts

  • Exosome Studies: Though not directly linked in the provided data, transmembrane proteins like C19orf77 are often studied in exosome biology, which is relevant to biomarker research (e.g., Parkinson’s disease exosome studies cited in ).

  • Stem Cell Biology: A homolog of C19orf77 was identified in hair follicle stem cell transcriptomes, suggesting potential roles in epithelial-melanocyte coordination .

Future Research Directions

  1. Functional Studies: Clarify the protein’s role in membrane dynamics and signaling pathways.

  2. Disease Associations: Investigate potential links to pathologies, leveraging exosome proteomics (e.g., parallels to LRRK2 biomarker research ).

  3. Structural Analysis: Resolve full-length protein structure to identify interaction domains.

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please include this information in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributor.
Please note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as an additional fee will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of our products depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of your specified tag.
Synonyms
SMIM24; C19orf77; HSPC323; Small integral membrane protein 24
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-130
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
SMIM24
Target Protein Sequence
QQATEHRLKPWLVGLAAVVGFLFIVYLVLLANRLWCSKARAEDEEETTFRMESNLYQDQS EDKREKKEAKEKEEKRKKEKKTAKEGESNLGLDLEEKEPGDHERAKSTVM
Uniprot No.

Target Background

Database Links

HGNC: 37244

KEGG: hsa:284422

UniGene: Hs.130714

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is C19orf77 and what are its known aliases?

C19orf77, now officially designated as SMIM24 (small integral membrane protein 24), is a protein-coding gene located on chromosome 19p13.3 . This protein is also known by several other aliases including transmembrane protein HSPC323 and MARDI . The protein belongs to the PDZK1-interacting protein 1/SMIM24 family and is predicted to function as an integral membrane protein.

What is the structural organization of the SMIM24 protein?

SMIM24 is a relatively small transmembrane protein. The human protein (UniProt ID: O75264, Entrez Gene ID: 284422) contains specific domains that characterize it as a membrane protein . Studies with recombinant protein fragments, particularly amino acids 52-99, have been used as control fragments for antibody validation . The protein structure contains transmembrane regions that anchor it to cellular membranes, consistent with its classification as an integral membrane protein.

How conserved is SMIM24 across species?

SMIM24 shows moderate conservation across mammalian species. The human SMIM24 protein shares approximately 44% sequence identity with mouse and rat orthologs in some regions . Higher identity (50% for mouse and 53% for rat) has been reported for specific immunogenic sequences . The gene is also found in aquatic mammals, as demonstrated by its identification in Lipotes vexillifer (Yangtze River dolphin) and in zebrafish, where it is annotated as smim24 (ZDB-GENE-081104-117) .

What are the recommended methods for detecting endogenous SMIM24 expression in tissue samples?

For detecting endogenous SMIM24 in tissue samples, researchers should consider a multi-modal approach:

  • Immunohistochemistry (IHC): Using validated antibodies such as the SMIM24 polyclonal antibody to visualize protein localization in tissue sections. Appropriate controls, including the use of recombinant protein fragments (aa 52-99) for blocking experiments, are essential for confirming specificity.

  • Western Blotting: For protein expression quantification, western blotting with specific antibodies can be employed. Pre-incubation of the antibody with a 100x molar excess of protein fragment control for 30 minutes at room temperature is recommended for blocking experiments to confirm specificity .

  • ELISA: Quantitative measurement of SMIM24 in tissue homogenates, cell lysates, and biological fluids can be performed using specific ELISA kits with a detection range of approximately 0.156-10 ng/ml .

  • RNA-seq or qPCR: For transcriptomic analysis, quantifying SMIM24 mRNA expression using primers specific to the gene sequence.

What expression systems are recommended for producing recombinant C19orf77/SMIM24?

The optimal expression system depends on research objectives and required post-translational modifications:

For fusion tags, options include His-tag (for purification), FLAG-tag (for detection), or larger tags like MBP or GST that may enhance solubility. Tag position (N- or C-terminal) should be optimized to avoid interfering with protein function .

How can transcriptomic approaches be utilized to understand SMIM24 function in different cell types?

Transcriptomic approaches for SMIM24 functional analysis should include:

  • Single-cell RNA sequencing: This approach can reveal cell type-specific expression patterns of SMIM24 across tissues. As demonstrated in pancreatic islet studies , single-cell transcriptome analyses can identify cell populations with differential expression of specific genes, potentially revealing the cellular context of SMIM24 function.

  • Network analysis: Utilizing approaches similar to those in the TraRe computational method , researchers can identify regulatory networks involving SMIM24. This involves:

    • Constructing gene regulatory networks to identify transcription factors that regulate SMIM24

    • Performing co-expression analysis to identify genes with expression patterns similar to SMIM24

    • Identifying potential sub-modules or regulatory programs where SMIM24 might play a role

What experimental approaches are recommended for investigating SMIM24 function in cellular models?

To investigate SMIM24 function in cellular models:

  • CRISPR/Cas9-mediated gene editing: Generate knockout or knockin cell lines to study loss-of-function or gain-of-function phenotypes, respectively. This approach can be modeled after studies examining gene functions in hair follicle stem cells .

  • Inducible expression systems: Implement systems similar to the inducible-Cre lines used in hair follicle studies to control the timing of SMIM24 expression or deletion in specific cell populations.

  • Protein-protein interaction studies:

    • Co-immunoprecipitation followed by mass spectrometry to identify binding partners

    • Proximity labeling approaches (BioID or APEX) to identify proteins in the vicinity of SMIM24 in the membrane

    • Yeast two-hybrid or mammalian two-hybrid systems for targeted interaction studies

  • Subcellular localization: Use fluorescently tagged constructs or immunofluorescence with specific antibodies to determine precise localization within membrane compartments.

How might SMIM24 function be linked to signaling pathways, particularly G-protein coupled receptor (GPCR) signaling?

While direct evidence linking SMIM24 to GPCR signaling is limited in the search results, GPCR pathways were identified in pathway analysis related to various conditions . To investigate potential connections:

  • Pathway analysis: Perform differential expression analysis comparing conditions with normal versus altered SMIM24 expression, followed by pathway enrichment focusing on:

    • GPCR ligand binding

    • Class A/1 (rhodopsin-like receptors)

    • GPCR downstream signaling

    • Peptide ligand binding receptors

    PathwayP-valueNo. of genes
    GPCR ligand binding0.000132
    Class A/1 (rhodopsin like receptors)0.003723
    Signaling by GPCRs0.007752
    Peptide ligand binding receptors0.019015
    GPCR downstream signaling0.019048
  • Second messenger assays: Measure changes in second messengers (cAMP, Ca²⁺, IP₃) in response to SMIM24 overexpression or knockdown to assess impact on GPCR signaling.

  • Receptor internalization assays: Determine if SMIM24 affects the trafficking or internalization of specific GPCRs using fluorescently labeled receptors.

What methodologies can be employed to investigate potential roles of SMIM24 in disease conditions, particularly in cancer models?

To investigate SMIM24's potential roles in disease conditions:

  • Analysis of genomic alterations: Employ approaches similar to those used in uveal melanoma studies to examine:

    • Copy number alterations (CNAs) affecting the SMIM24 locus

    • Somatic mutations in SMIM24 across cancer types

    • Expression correlation with known driver genes

  • Epigenetic regulation analysis: Following methodologies from epigenetic association studies :

    • Analyze DNA methylation patterns in the SMIM24 locus across disease states

    • Perform bisulfite sequencing to precisely map methylation sites

    • Correlate methylation patterns with expression levels

  • Functional genomics screens: Use CRISPR/Cas9 or RNAi screens to assess SMIM24's impact on:

    • Cell proliferation and survival

    • Migration and invasion in cancer models

    • Response to therapeutic agents

  • Patient-derived models: Analyze SMIM24 expression in:

    • Patient-derived xenografts

    • Organoid models

    • Primary patient samples, correlating with clinical outcomes

How can researchers effectively investigate the role of SMIM24 in specific cellular compartments, particularly lysosomes?

Based on studies investigating lysosomal biogenesis and function , researchers should consider:

  • Lysosomal colocalization and function assays:

    • Assess colocalization of SMIM24 with lysosomal markers (LAMP1, LAMP2) using confocal microscopy

    • Measure lysosomal content using LysoTracker dyes in cells with altered SMIM24 expression

    • Evaluate lysosomal enzyme activity using specific substrates (e.g., Magic Red for cathepsin B activity)

    • Analyze cargo trafficking to lysosomes using DQ-BSA-Green fluorescence activation

  • Transcriptional regulation:

    • Investigate whether SMIM24 affects expression of lysosomal genes by analyzing the CLEAR consensus promoter element

    • Assess impact on transcription factor EB (TFEB) activity using CLEAR reporter constructs

    • Determine if SMIM24 influences TFEB nuclear localization under different conditions

  • Lysosomal proteomics:

    • Perform lysosomal fractionation followed by mass spectrometry to identify potential interactions of SMIM24 with lysosomal proteins

    • Conduct proximity labeling experiments to identify proteins near SMIM24 in lysosomal membranes

What controls should be implemented when studying SMIM24 in experimental models?

Proper controls are essential for rigorous SMIM24 research:

  • Antibody validation:

    • Use recombinant protein fragments (such as aa 52-99) for blocking experiments with antibodies

    • Include isotype controls for immunoprecipitation experiments

    • Verify antibody specificity using knockout or knockdown models

  • Expression system controls:

    • Include empty vector controls in recombinant expression experiments

    • Use wild-type protein alongside mutant constructs

    • Consider species differences when using orthologs (human SMIM24 shares only 44-53% identity with mouse and rat proteins in certain regions)

  • Functional assays:

    • Include positive and negative controls for pathway analysis

    • Perform rescue experiments to confirm specificity of phenotypes

    • Use multiple cell lines to ensure findings are not cell-type specific

What methodological considerations should be addressed when analyzing SMIM24 expression data from multi-omics studies?

When analyzing SMIM24 in multi-omics datasets:

  • Batch effect correction: Apply methods like principal variance component analysis (PVCA) to identify and correct for technical variations and covariates .

  • Integration approaches: Utilize tools like Multi-Omics Factor Analysis (MOFA) that can accommodate missing values and provide rigorous statistics for multi-omics datasets . This approach can identify latent factors explaining variations across different types of data.

  • Statistical considerations:

    • Apply appropriate multiple testing corrections (e.g., Bonferroni or FDR)

    • Utilize robust statistical methods for differential expression analysis

    • Consider the potential impact of outliers on small sample sizes

  • Validation strategies:

    • Confirm key findings using orthogonal techniques

    • Split datasets into discovery and validation cohorts when possible

    • Consider cross-species validation to strengthen evolutionary conservation claims

What emerging technologies might advance our understanding of SMIM24 function and regulation?

Several cutting-edge technologies could significantly advance SMIM24 research:

  • Spatial transcriptomics: Technologies that preserve spatial information while measuring gene expression could reveal tissue-specific localization patterns of SMIM24, particularly in complex tissues.

  • Cryo-electron microscopy: For structural determination of this transmembrane protein, potentially revealing functional domains and interaction surfaces.

  • Single-molecule imaging techniques: To visualize SMIM24 trafficking and interactions in living cells in real-time.

  • Proteomics approaches:

    • Thermal proteome profiling to identify drug targets affecting SMIM24

    • Cross-linking mass spectrometry to map protein-protein interaction interfaces

    • Top-down proteomics to characterize post-translational modifications

  • Organoid and microphysiological systems: Advanced 3D culture models that better recapitulate in vivo conditions for functional studies of SMIM24.

How might researchers effectively design studies to elucidate potential roles of SMIM24 in different tissue types?

For comprehensive tissue-specific studies of SMIM24:

  • Multi-tissue expression profiling: Assess expression patterns across tissues using approaches similar to the hair follicle stem cell studies , which examined specific cell populations using markers and conditional knockout models.

  • Conditional knockout strategies: Generate tissue-specific knockout models using Cre-lox systems, similar to the NFIB knockout studies in hair follicle stem cells .

  • Developmental timing considerations: Study expression and function at different developmental stages, as demonstrated in hair follicle morphogenesis studies .

  • Injury and stress models: Examine responses in various physiological challenges, such as wound repair models, where hair follicle-mediated re-epithelialization was studied in NFIB knockout mice .

  • Disease model selection: Based on expression data, prioritize disease models where SMIM24 might play significant roles, following approaches used to identify tumor-specific alterations in uveal melanoma .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.