Recombinant Human Transmembrane protein C1orf162 (C1orf162)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
C1orf162; Transmembrane protein C1orf162
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-155
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
C1orf162
Target Protein Sequence
MGGNGSTCKPDTERQGTLSTAAPTTSPAPCLSNHHNKKHLILAFCAGVLLTLLLIAFIFL IIKSYRKYRRERLPISPGPLLRWVPLLSGTMADHSKPQAPDPHSDPPAKLSSIPGESLTY ASTTFKLSEEKSNHLAENHSADFDPIVYAQIKVTN
Uniprot No.

Target Background

Database Links

HGNC: 28344

KEGG: hsa:128346

STRING: 9606.ENSP00000344218

UniGene: Hs.288010

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is C1orf162 and what are its structural characteristics?

C1orf162 is a human transmembrane protein encoded by a gene located on chromosome 1p13.2. The full-length human protein consists of 155 amino acids with an N-terminal His-tag when expressed recombinantly in E. coli systems . Its mouse homolog is slightly shorter at 132 amino acids . The protein is classified as an integral membrane protein, meaning it is embedded within the cellular membrane .

Structural Data:

FeatureHuman C1orf162Mouse C1orf162 homolog
Length155 amino acids132 amino acids
Gene locationChromosome 1p13.2-
AliasesMGC24133Transmembrane protein C1orf162 homolog
UniProt ID-Q3U7U4

What expression systems are commonly used for recombinant C1orf162 production?

Based on available research data, the following expression systems have been documented for C1orf162:

  • E. coli: Commonly used for expressing the full-length protein with an N-terminal His-tag

  • HEK293 cells: Used for producing human C1orf162 lysate, which may provide more native post-translational modifications

The choice of expression system depends on experimental requirements, with bacterial systems offering high yield but mammalian systems potentially providing more authentic protein modifications.

How should researchers assess the quality and integrity of recombinant C1orf162?

Quality assessment for recombinant C1orf162 should include:

  • Purity verification: SDS-PAGE analysis with a standard of >90% purity

  • Protein identity confirmation: Western blotting using antibodies specific to C1orf162 or to the fusion tag

  • Structural integrity: Circular dichroism spectroscopy to assess secondary structure elements typical of transmembrane proteins

  • Functional testing: Activity assays relevant to hypothesized functions, though specific functions of C1orf162 are still being characterized

What are critical factors in designing experiments with transmembrane proteins like C1orf162?

When designing experiments with transmembrane proteins, researchers should consider:

  • Membrane environment: The protein's native structure and function may depend on specific lipid compositions

  • Tag positioning: The position of purification tags (e.g., His-tag) may affect protein folding and function

  • Detergent selection: Appropriate detergents are crucial for maintaining protein stability during purification

  • Control selection: Include appropriate positive and negative controls specific to transmembrane protein experiments

  • ER membrane protein complex (EMC) interactions: Consider potential associations with EMC, which has been shown to be important for transmembrane protein biogenesis

How should recombinant C1orf162 be stored and handled to maintain stability?

Based on the provided information for recombinant transmembrane proteins:

  • Storage conditions: Store at -20°C/-80°C upon receipt

  • Aliquoting strategy: Divide into working aliquots to avoid repeated freeze-thaw cycles

  • Reconstitution protocol:

    • Briefly centrifuge before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to 5-50% final concentration for long-term storage

    • Default recommendation is 50% glycerol

  • Working solution stability: Store working aliquots at 4°C for up to one week

  • Buffer composition: Typically stored in Tris/PBS-based buffer with 6% Trehalose, pH 8.0

What experimental approaches are recommended for studying protein-protein interactions involving C1orf162?

Several methodologies can be employed to study interactions of transmembrane proteins like C1orf162:

  • Co-immunoprecipitation (Co-IP): Useful for identifying protein complexes, as demonstrated with other transmembrane proteins and the EMC

  • Proximity labeling: BioID or APEX2-based approaches for identifying neighboring proteins in membrane environments

  • Fluorescence-based techniques: FRET or BiFC to visualize interactions in live cells

  • Cross-linking mass spectrometry: To capture transient interactions and identify interaction interfaces

  • Yeast two-hybrid variants: Modified for membrane proteins, such as split-ubiquitin systems

How can gene expression analysis for C1orf162 be optimized in different experimental contexts?

Optimization of gene expression analysis for C1orf162 requires rigorous attention to:

  • Sample preparation quality: Careful sample acquisition and RNA extraction methods are essential as RNA degrades easily

  • Replication strategy: Include both technical replicates (confirming experimental accuracy) and biological replicates (demonstrating reproducibility across different samples)

  • SNP positioning: Evaluate SNP positioning to avoid issues with primer and probe annealing that could affect efficiency and specificity

  • Transcript variant awareness: Design assays that account for potential alternative splicing, as human C1orf162 has been reported to have at least 2 isoforms

  • Reference gene selection: Choose appropriate reference genes for normalization based on the experimental context

  • MIQE guidelines compliance: Follow Minimum Information for Publication of Quantitative Real-Time PCR Experiments guidelines to ensure reproducibility

What approaches are most effective for investigating the functional role of C1orf162?

To elucidate C1orf162 function, researchers should consider:

  • Loss-of-function studies: CRISPR-Cas9 knockout or siRNA knockdown to assess phenotypic changes

  • Gain-of-function analysis: Overexpression studies to identify potential dose-dependent effects

  • Localization studies: Fluorescent tagging or immunofluorescence to determine subcellular distribution

  • Interactome mapping: Identifying binding partners through proteomics approaches

  • Domain analysis: Creating truncated or mutated versions to identify functional domains

  • EMC association analysis: Investigate potential interactions with the ER membrane protein complex, which has been shown to be important for other transmembrane proteins

How does membrane environment affect C1orf162 function and how can this be studied?

The membrane environment likely plays a crucial role in C1orf162 function. Research approaches should include:

  • Reconstitution studies: Testing protein activity in different lipid compositions

  • Detergent screening: Identifying optimal detergents that maintain native structure and function

  • Membrane mimetics: Using nanodiscs or liposomes to create controlled membrane environments

  • Molecular dynamics simulations: Predicting how membrane composition affects protein structure

  • Site-directed spin labeling: Probing local environments at specific residues within the membrane

What are common challenges when working with recombinant transmembrane proteins and their solutions?

Common challenges and solutions include:

ChallengeSolution Approach
Low expression yieldOptimize codon usage, try different expression systems, adjust induction conditions
Protein aggregationScreen detergents, optimize buffer conditions, consider fusion partners
Purification difficultiesAdjust tag position, optimize purification conditions, use specialized resins
Loss of native foldingDevelop gentle purification protocols, validate using functional assays
Inclusion body formationDevelop refolding protocols or use eukaryotic expression systems
Non-specific interactionsInclude appropriate negative controls and stringent washing conditions

How can researchers validate that recombinant C1orf162 maintains its native conformation?

Validation approaches should include:

  • Secondary structure analysis: Circular dichroism spectroscopy to confirm expected structural elements

  • Thermal stability assessment: Differential scanning fluorimetry to monitor protein folding stability

  • Binding studies: If ligands or interacting partners are known, confirm their binding

  • Functional assays: Develop and implement functional assays specific to the protein's known activities

  • Conformational antibodies: Use antibodies that recognize correctly folded epitopes

  • Native PAGE: Compare migration patterns with the native protein extracted from cells

How should experimental design for C1orf162 research address potential variables and controls?

A robust experimental design for C1orf162 research must include:

  • Systematic variable control: Identify and control variables that could affect outcomes, such as temperature, pH, salt concentration, and detergent types

  • Appropriate controls: Include both positive and negative controls specific to transmembrane proteins

  • Biological relevance: Design experiments that mimic physiological conditions when possible

  • Replication strategy: Include sufficient biological and technical replicates for statistical validity

  • Blinding procedures: Implement blinding when scoring or analyzing subjective outcomes

  • Statistical approach: Pre-plan statistical analysis methods appropriate for the experimental design

  • Protocol standardization: Develop and document detailed protocols to ensure reproducibility

What data analysis approaches are recommended for C1orf162 interaction studies?

When analyzing C1orf162 interaction data, researchers should employ:

  • Statistical rigor: Apply appropriate statistical tests with correction for multiple comparisons

  • Quantitative analysis: Use quantitative rather than qualitative measures whenever possible

  • Background correction: Account for non-specific binding common with hydrophobic transmembrane proteins

  • Replication analysis: Compare results across multiple experimental replicates

  • Cross-validation: Confirm key findings using orthogonal experimental approaches

  • Integration with existing data: Compare results with known interaction networks or pathways

  • Visualization techniques: Employ network analysis tools to visualize complex interaction patterns

What are promising areas for future research on C1orf162?

Based on current knowledge, promising research directions include:

  • Functional characterization: Determining the primary cellular function of C1orf162

  • Disease associations: Investigating potential roles in disease processes

  • Structural biology: Resolving the three-dimensional structure using cryo-EM or X-ray crystallography

  • Interactome mapping: Comprehensive identification of protein-protein interactions

  • Tissue-specific expression analysis: Characterizing expression patterns across different tissues

  • EMC dependency: Investigating whether C1orf162 biogenesis depends on the ER membrane protein complex, as seen with other transmembrane proteins

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.