Recombinant Human Transmembrane protein C5orf28 (C5orf28)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates. Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process. The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TMEM267; C5orf28; Transmembrane protein 267
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMEM267
Target Protein Sequence
MASETEKTHALLQTCSTESLISSLGLGAFCLVADRLLQFSTIQQNDWLRALSDNAVHCVI GMWSWAVVTGIKKKTDFGEIILAGFLASVIDVDHFFLAGSMSLKAALTLPRRPFLHCSTV IPVVVLTLKFTMHLFKLKDSWCFLPWMLFISWTSHHIRDGIRHGLWICPFGKTSPLPFWL YVIITSSLPHICSFVMYLTGTRQMMSSKHGVRIDV
Uniprot No.

Target Background

Database Links

HGNC: 26139

KEGG: hsa:64417

UniGene: Hs.732093

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Transmembrane protein C5orf28 and what are its alternative names?

Transmembrane protein C5orf28 is a human protein encoded by the C5orf28 gene. It is alternatively known as "transmembrane protein 267" according to recent nomenclature updates . The protein has a Uniprot ID of Q0VDI3 and is classified as a protein-coding gene product . While the full functional characterization of this protein remains under investigation, its transmembrane nature suggests involvement in membrane-associated cellular processes. The protein's classification as a homolog indicates evolutionary conservation of structure and potentially function across species.

What is known about the molecular structure of C5orf28?

The C5orf28 protein is characterized as a single-pass α-helical transmembrane domain (TMD) protein. While detailed structural information is limited, transmembrane proteins typically contain hydrophobic regions that span the lipid bilayer of cellular membranes . Based on comparative analysis with similar transmembrane proteins, C5orf28 likely adopts specific oligomeric states that influence its functional properties. Recent advances in de novo design strategies for transmembrane domains have provided insights into how proteins like C5orf28 may self-assemble through defined interfaces . The protein sequence from the available records indicates a coding region of 609 base pairs, suggesting a relatively compact protein structure .

What experimental systems are available for studying C5orf28?

Researchers studying C5orf28 have several experimental tools at their disposal. These include:

  • Gene expression systems: cDNA ORF clones derived from LOC108740611 (transmembrane protein C5orf28 homolog) are commercially available for expression studies . These clones can be delivered in standard vectors such as pcDNA3.1+/C-(K)DYK or customized vectors for expression/transfection experiments.

  • Immunological tools: C5orf28 polyclonal antibodies raised in rabbit are available for immunological detection methods . These antibodies have been validated for techniques such as ELISA and immunofluorescence, with recommended dilutions of 1:50-1:200 for IF applications.

  • Cell models: Based on immunofluorescence data, HeLa cells have been successfully used to study C5orf28 localization and can serve as a model system for investigating this protein .

How should researchers design experiments to study C5orf28 function?

When designing experiments to study C5orf28 function, researchers should apply rigorous experimental design principles to minimize bias and error. First, clearly define the independent and dependent variables in your experimental setup3. For C5orf28 functional studies, the independent variable might be protein expression levels or specific mutations, while dependent variables could include cellular localization, interaction partners, or downstream signaling effects.

To minimize experimental error:

  • Use multiple biological and technical replicates to account for sampling error

  • Employ quantitative measurements using calibrated instruments to reduce measurement error

  • Implement blind analysis methods to reduce researcher bias, especially when analyzing qualitative data3

  • Include appropriate positive and negative controls in all experiments

When studying transmembrane proteins like C5orf28, consider membrane-specific techniques such as those used in recent de novo design studies of transmembrane domains . These approaches can help elucidate how C5orf28's structure relates to its function within the membrane environment.

What controls should be included when studying C5orf28 interactions?

When investigating C5orf28 protein interactions, proper controls are essential for generating reliable and interpretable data:

  • Negative controls:

    • Non-transfected cells for background signal determination

    • Cells expressing an unrelated transmembrane protein with similar topology

    • Isotype control antibodies for immunoprecipitation experiments

    • Empty vector controls for expression studies

  • Positive controls:

    • Known interaction partners of similar transmembrane proteins

    • Artificial constructs with validated interaction domains

  • Validation controls:

    • Reciprocal co-immunoprecipitation experiments

    • Multiple detection methods (e.g., immunofluorescence co-localization followed by proximity ligation assays)

    • Competition assays with excess unlabeled protein

Recent advances in transmembrane domain engineering demonstrate the importance of validating interaction specificity through multiple experimental approaches . When studying C5orf28 interactions, researchers should consider potential cross-talk with endogenous membrane proteins, as observed with other transmembrane domains like CD28 TMD .

How does oligomerization state affect C5orf28 function?

While specific data on C5orf28 oligomerization is limited, research on transmembrane domains provides valuable insights into how oligomeric state influences protein function. Recent studies using de novo-designed transmembrane domains demonstrate that oligomeric state directly impacts receptor signaling capacity .

For example, researchers found that the oligomeric state encoded by receptor transmembrane domains linearly correlated with both in vitro cytokine release and in vivo antitumor activity in CAR T cells . This suggests that if C5orf28 forms oligomers, its oligomeric state may similarly regulate its signaling capabilities.

To investigate C5orf28 oligomerization:

  • Apply computational modeling approaches similar to those described for de novo design of transmembrane domains

  • Use biochemical techniques such as crosslinking and gel electrophoresis to detect oligomeric species

  • Employ biophysical methods like analytical ultracentrifugation or multi-angle light scattering

  • Consider X-ray crystallography for definitive structural validation, as used in the programmable membrane protein studies

Understanding the oligomeric state of C5orf28 may provide critical insights into its functional mechanisms and potential therapeutic targeting strategies.

What role might C5orf28 play in membrane organization and receptor signaling?

Based on studies of other transmembrane proteins, C5orf28 may participate in membrane organization and receptor signaling in several ways:

  • Scaffold function: C5orf28 might serve as a scaffold for assembling signaling complexes within the membrane, similar to how designed transmembrane domains can program specific oligomeric interactions .

  • Signal modulation: The protein could modulate receptor signaling through specific transmembrane domain interactions. Recent research has shown that transmembrane domains can significantly impact receptor signaling output, with different TMDs producing distinct functional profiles .

  • Membrane microdomain organization: C5orf28 might contribute to the formation or stability of membrane microdomains, potentially influencing receptor clustering and signaling efficiency.

Research approaches to investigate these potential roles include:

  • Membrane fractionation studies to determine C5orf28 localization within membrane microdomains

  • Proximity labeling techniques to identify proteins in close spatial association with C5orf28

  • Functional assays comparing wild-type and TMD mutant versions of C5orf28

  • Super-resolution microscopy to visualize C5orf28 distribution and dynamics in the membrane

The emerging understanding of transmembrane domain functions beyond simple membrane anchoring provides a framework for investigating C5orf28's potential roles in complex membrane-associated processes .

What are the optimized protocols for immunofluorescent detection of C5orf28?

Based on validated protocols for C5orf28 antibodies, the following immunofluorescence procedure is recommended:

Materials required:

  • C5orf28 Polyclonal Antibody (e.g., catalog # A64618)

  • Secondary antibody: Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)

  • Cell line: HeLa cells have been validated for C5orf28 detection

  • Standard IF reagents (fixative, permeabilization solution, blocking buffer)

Procedure:

  • Culture cells on coverslips or in chamber slides to 70-80% confluence

  • Fix cells with 4% paraformaldehyde for 15 minutes at room temperature

  • Permeabilize with 0.1% Triton X-100 for 10 minutes

  • Block with 3% BSA in PBS for 1 hour at room temperature

  • Incubate with C5orf28 primary antibody at a dilution of 1:50-1:200 in blocking buffer overnight at 4°C

  • Wash 3x with PBS

  • Incubate with Alexa Fluor 488-conjugated secondary antibody at manufacturer's recommended dilution for 1 hour at room temperature

  • Wash 3x with PBS

  • Counterstain nuclei with DAPI

  • Mount and visualize using a confocal or fluorescence microscope

Critical considerations:

  • Include a negative control (primary antibody omitted) to assess background fluorescence

  • For co-localization studies, ensure antibodies are raised in different species to avoid cross-reactivity

  • When quantifying results, capture multiple fields and analyze data blind to experimental conditions to minimize bias3

How can researchers effectively use recombinant C5orf28 in functional studies?

Recombinant C5orf28 can be a powerful tool for functional studies when used appropriately:

Expression systems:
Commercially available C5orf28 cDNA ORF clones can be expressed in various systems:

  • The pcDNA3.1+/C-(K)DYK vector system provides C-terminal DYKDDDDK tags for detection and purification

  • CloneEZ™ Seamless cloning technology allows for insertion into customized vectors for specialized applications

Experimental applications:

  • Overexpression studies: Transfect cells with C5orf28 expression constructs to assess the effect of increased protein levels on cellular processes.

  • Structure-function analysis: Generate truncated or mutated versions of C5orf28 to identify functional domains, similar to the approach used in transmembrane domain engineering studies .

  • Interaction studies: Use tagged C5orf28 constructs for pull-down or co-immunoprecipitation experiments to identify binding partners.

  • Localization studies: Express fluorescently tagged C5orf28 to track its subcellular localization and dynamics in living cells.

Data analysis considerations:

  • Account for propagation of uncertainty when measuring multiple parameters involving C5orf283

  • Distinguish between systematic errors (e.g., calibration issues) and random errors in measurements3

  • Use statistical tests appropriate for the data distribution and experimental design

How should researchers analyze potential contradictions in C5orf28 functional data?

When faced with contradictory data regarding C5orf28 function, researchers should apply systematic analytical approaches:

  • Methodological reconciliation:

    • Compare experimental conditions, cell types, and reagents used in different studies

    • Assess differences in protein expression levels, as overexpression may lead to non-physiological effects

    • Evaluate the specificity of detection methods and potential cross-reactivity with related proteins

  • Data verification:

    • Repeat key experiments using multiple independent approaches

    • Implement blind analysis protocols to minimize experimenter bias3

    • Consider quantitative rather than qualitative assessments where possible

  • Computational analysis:

    • Use statistical methods appropriate for the specific experimental design

    • Calculate confidence intervals and effect sizes to better compare results across studies

    • Apply propagation of uncertainty calculations when combining measurements3

  • Hypothesis refinement:

    • Consider that apparent contradictions may reflect context-dependent functions of C5orf28

    • Develop new hypotheses that accommodate seemingly disparate observations

    • Design critical experiments specifically aimed at resolving contradictions

When reporting contradictory findings, present all data transparently, discuss potential sources of discrepancy, and avoid confirmation bias by considering alternative explanations for the observations.

What statistical approaches are most appropriate for analyzing C5orf28 expression data?

The choice of statistical methods for C5orf28 expression analysis depends on the experimental design and data characteristics:

For comparing expression levels between two conditions:

  • Student's t-test for normally distributed data with equal variances

  • Welch's t-test for normally distributed data with unequal variances

  • Mann-Whitney U test for non-normally distributed data

For comparing multiple conditions:

  • One-way ANOVA followed by appropriate post-hoc tests (e.g., Tukey's HSD) for normally distributed data

  • Kruskal-Wallis test followed by Dunn's test for non-normally distributed data

For correlation analyses:

  • Pearson correlation coefficient for linear relationships between normally distributed variables

  • Spearman rank correlation for non-linear relationships or non-normally distributed data

Important considerations:

  • Test data for normality before selecting parametric or non-parametric tests

  • Account for multiple testing when analyzing expression across different tissues or conditions

  • Report effect sizes along with p-values to indicate biological significance

  • Calculate and report the propagation of uncertainty when combining measurements3

  • Consider using blind analysis techniques to minimize bias, particularly for subjective assessments3

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.