Recombinant Human Transmembrane protein 243 (TMEM243)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
TMEM243; C7orf23; Transmembrane protein 243; MDR1- and mitochondrial taxol resistance-associated protein; MM-TRAG
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMEM243
Target Protein Sequence
MEDFATRTYGTSGLDNRPLFGETSAKDRIINLVVGSLTSLLILVTLISAFVFPQLPPKPL NIFFAVCISLSSITACILIYWYRQGDLEPKFRKLIYYIIFSIIMLCICANLYFHDVGR
Uniprot No.

Target Background

Gene References Into Functions
  1. Studies demonstrated that MGC4175, fused to the C-terminus of enhanced green fluorescent protein (EGFP), localized to the mitochondria. Overexpression was not attributed to genomic amplification or gene rearrangement. PMID: 15556294
Database Links

HGNC: 21707

OMIM: 616993

KEGG: hsa:79161

UniGene: Hs.619593

Protein Families
TMEM243 family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed.

Q&A

What is the basic structure and cellular localization of TMEM243?

TMEM243 (Transmembrane protein 243) is a protein encoded by the TMEM243 gene on chromosome 7 (7q21.12) in humans . The gene contains 5 exons and encodes a 118-amino acid protein . Immunohistochemical evidence demonstrates both membranous and cytoplasmic localization patterns, with strong expression observed in squamous epithelial cells of human esophagus .

Methodological approach for structural analysis:

  • Bioinformatic analysis using protein prediction tools to identify potential transmembrane domains

  • Subcellular fractionation followed by Western blot analysis to confirm membrane association

  • Immunofluorescence microscopy using specific antibodies (such as PACO41246) at dilutions of 1:50-1:200 for cellular localization studies

What experimental methods are most effective for studying TMEM243 expression?

Several complementary approaches can be used to study TMEM243 expression:

MethodApplicationRecommended ConditionsAdvantages
Western BlotProtein expressionUse validated antibodies like PACO41246Quantitative analysis of protein levels
Immunohistochemistry (IHC)Tissue localization1:20-1:200 dilution of antibodiesVisualizes protein in tissue context
Immunofluorescence (IF)Cellular localization1:50-1:200 dilutionHigh-resolution subcellular localization
qRT-PCRmRNA expressionDesign primers spanning exon junctionsSensitive quantification of transcript levels
ELISAProtein quantification1:2000-1:10000 antibody dilutionHigh throughput screening

For optimal results, researchers should validate antibody specificity using positive controls such as colon cancer, small intestine, or A549 cells where TMEM243 expression has been confirmed .

How is recombinant TMEM243 protein typically produced for research purposes?

Recombinant TMEM243 protein can be produced using several expression systems:

Expression SystemTagAdvantagesApplications
E. coliHis-tagHigh yield, cost-effectiveFull-length protein (1-118aa)
HEK293Myc/DDK-tagMammalian post-translational modificationsHuman and mouse TMEM243 variants
HEK293DDK&Myc with C13/N15 labelingIsotope-labeled for structural studiesNMR and other structural analyses

Methodological considerations:

  • For membrane proteins like TMEM243, mammalian expression systems (such as HEK293) often provide better folding and post-translational modifications

  • The choice of tag (His, Myc/DDK) should be based on downstream applications

  • Purification typically involves affinity chromatography based on the chosen tag

  • For full-length human TMEM243, expression constructs covering amino acids 1-118 are recommended

What are the most reliable antibodies for TMEM243 detection?

Several validated antibodies are available for TMEM243 research:

AntibodyHostApplicationsDilutionsEpitope
PACO41246RabbitELISA, IHC, IFELISA: 1:2000-1:10000, IHC: 1:20-1:200, IF: 1:50-1:200Human TMEM243 (1-31AA)
HPA014918RabbitIHC0.05 mg/mlHuman TMEM243
CSB-PA874810LB01HURabbit (HRP-conjugated)ELISANot specifiedHuman TMEM243 (1-31AA)

Methodological recommendations:

  • Validate antibodies using positive controls such as human colon cancer tissue, small intestine tissue, or A549 cells

  • Optimize antibody dilutions for each specific application and sample type

  • For immunofluorescence, secondary antibodies such as Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG have been successfully used

  • Proper storage at -20°C or -80°C is recommended to maintain antibody activity

What model systems are available for studying TMEM243 function?

Researchers can utilize several model systems to investigate TMEM243 function:

Model SystemApplicationsConsiderations
Human cell lines (e.g., A549)Protein localization, interaction studiesVerified for TMEM243 expression
Mouse modelsIn vivo functional studiesTmem243 homolog available (MGI:3606159)
Recombinant protein systemsBiochemical characterizationAvailable as full-length (1-118 aa) with various tags
Bovine systemsComparative studiesRecombinant C7Orf23 homolog available

When selecting a model system, researchers should consider:

  • The specific research question (protein interaction, localization, function)

  • Conservation of protein structure and function across species

  • Availability of reagents and genetic manipulation tools for the model

What are the challenges in studying TMEM243 protein-protein interactions?

TMEM243 is implicated in vesicle transport and protein sorting processes , making its interactome crucial to understand. Several methodological challenges exist:

  • Membrane protein solubilization issues:

    • Requires careful selection of detergents to maintain native structure

    • May need crosslinking approaches to capture transient interactions

    • Consider specialized techniques for membrane protein interactions

  • Limited knowledge of interaction partners:

    • Start with hypothesis-driven approaches based on vesicular trafficking pathways

    • Use proximity labeling approaches (BioID, APEX) to identify spatial interactors

    • Validate findings with co-immunoprecipitation using antibodies like PACO41246

  • Technical recommendations:

    • For co-IP experiments, use cell types with confirmed TMEM243 expression like A549 cells

    • Consider membrane fraction enrichment before immunoprecipitation

    • Validate interactions with multiple antibodies and reciprocal pull-downs

How does TMEM243 expression vary across different tissues and disease states?

Understanding TMEM243 expression patterns provides insights into its function:

Based on immunohistochemistry data, TMEM243 shows:

  • Strong membranous and cytoplasmic expression in squamous epithelial cells of human esophagus

  • Expression in colon cancer tissues

  • Detectable expression in small intestine tissue

  • Expression in A549 lung cancer cell line

Methodological approaches for comprehensive expression analysis:

  • Multi-tissue Western blot or qPCR panel with validated antibodies or primers

  • Immunohistochemistry on tissue microarrays using antibodies like HPA014918 (0.05 mg/ml)

  • Analysis of cancer dependencies using resources like DepMap

  • Single-cell RNA-seq to identify cell type-specific expression patterns

  • Comparative analysis between normal and diseased tissues to identify aberrant expression

What experimental approaches can be used to investigate TMEM243's role in vesicular trafficking?

Given TMEM243's potential involvement in vesicular trafficking and membrane dynamics , several specialized approaches can be employed:

  • Live-cell imaging methodologies:

    • Generate stable cell lines expressing fluorescently-tagged TMEM243

    • Use time-lapse confocal microscopy to track TMEM243-positive vesicles

    • Employ photoactivatable fluorescent proteins to track specific protein pools

  • Co-localization studies with organelle and vesicular markers:

    • Perform dual immunofluorescence with TMEM243 antibodies (dilution 1:50-1:200) and markers for:

      • Endoplasmic reticulum

      • Golgi apparatus

      • Early/late endosomes

      • Lysosomes

      • Recycling endosomes

  • Functional trafficking assays:

    • Measure endocytosis/exocytosis rates following TMEM243 depletion

    • Track transport of model cargo proteins in TMEM243-depleted cells

    • Analyze vesicle dynamics using live-cell imaging techniques

What methodologies are recommended for studying TMEM243 post-translational modifications?

Post-translational modifications (PTMs) often regulate membrane protein function and trafficking:

PTM TypeDetection MethodConsiderations for TMEM243
PhosphorylationPhospho-specific antibodies, MS/MSFocus on cytoplasmic domains
GlycosylationGlycosidase treatment, lectins, MSParticularly relevant for extracellular domains
UbiquitinationUbiquitin pull-down, MSMay regulate protein turnover or sorting
PalmitoylationAcyl-biotin exchange, click chemistryCould affect membrane association

Methodological approach:

  • Immunoprecipitate TMEM243 using validated antibodies like PACO41246

  • Subject purified protein to mass spectrometry analysis

  • Validate findings using site-directed mutagenesis of identified modification sites

  • Assess functional consequences of mutations using trafficking or interaction assays

  • For structural studies, consider using labeled recombinant protein (C13 and N15)

How can CRISPR-Cas9 be optimized for TMEM243 gene editing studies?

CRISPR-Cas9 offers powerful approaches to study TMEM243 function:

ApproachApplicationDesign Considerations for TMEM243
KnockoutComplete loss-of-functionTarget early exons within the 5-exon gene structure
KnockinTagging, specific mutationsConsider membrane topology when introducing tags
CRISPRiTranscriptional repressionTarget promoter region for efficient repression
CRISPRaTranscriptional activationMultiple sgRNAs may enhance effect

Methodological recommendations:

  • Design sgRNAs targeting multiple sites within the TMEM243 gene (located at Chr7: 87196160-87220587)

  • For membrane proteins like TMEM243, consider:

    • C-terminal tagging may be preferable to N-terminal to avoid disrupting signal peptides

    • Fluorescent protein tags may affect membrane insertion

  • Validate edits by genomic sequencing and confirm protein expression changes using validated antibodies

  • Functional validation should include vesicular trafficking assays given TMEM243's suspected role

How can researchers address contradictory data regarding TMEM243 function?

When facing contradictory findings about TMEM243 function:

  • Systematic comparison of experimental conditions:

    • Cell types used (expression may vary across cell lines)

    • Expression levels (overexpression vs. endogenous)

    • Antibody specificity (validate with multiple antibodies like PACO41246 and HPA014918)

    • Subcellular fractionation methods (critical for membrane proteins)

  • Comprehensive functional validation:

    • Use multiple complementary approaches to test hypotheses

    • Combine genetic (CRISPR, RNAi) and biochemical approaches

    • Test in multiple model systems (human cells, mouse models)

  • Considerations specific to TMEM243:

    • As a membrane protein involved in trafficking, its function may be context-dependent

    • Consider potential differences between species (human vs. mouse Tmem243)

    • Interaction partners may vary by cell type or physiological condition

    • Evaluate post-translational modifications that might affect function

What are the latest methodological approaches for investigating TMEM243's role in disease pathogenesis?

While research on TMEM243's role in disease is still emerging:

  • Cancer research methodologies:

    • Analyze TMEM243 expression in cancer vs. normal tissues using validated antibodies

    • Use cancer dependency mapping resources like DepMap to identify context-specific requirements

    • Investigate correlations between TMEM243 expression and clinical outcomes in public datasets

    • As TMEM243 is involved in vesicular trafficking , investigate its potential role in drug resistance mechanisms

  • Experimental design recommendations:

    • Use isogenic cell line pairs (CRISPR knockout/control) to isolate TMEM243-specific effects

    • Employ patient-derived xenograft models to study TMEM243 in a more physiologically relevant context

    • Consider high-content imaging to capture complex phenotypes related to vesicular trafficking

    • Integrate transcriptomic and proteomic analyses to identify affected pathways

  • Technical considerations:

    • When using immunohistochemistry for tissue analysis, optimize conditions with antibodies like HPA014918 (0.05 mg/ml)

    • For protein quantification in clinical samples, ELISA using antibodies like CSB-PA874810LB01HU may be suitable

    • Preserve sample integrity with appropriate buffers (e.g., 50% Glycerol, 0.01M PBS, pH 7.4)

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.