Recombinant Human Transmembrane protein C9orf71 (C9orf71)

Shipped with Ice Packs
In Stock

Description

General Information

The C9orf72 protein, derived from the C9ORF72 gene, garnered significant attention after a non-coding repeat expansion in it was identified as the most frequent cause of frontotemporal dementia (FTD) and amyotrophic lateral sclerosis (ALS) in 2011 . Before this discovery, C9ORF72 and its functions were largely unknown . The mutation in C9ORF72 appears to induce both loss-of-function and gain-of-function effects, the latter involving aggregating expanded RNAs and dipeptide repeat proteins (DPRs) .

Structure and Function

C9orf72 is a cytoplasmic protein found to be low in abundance and highly soluble . The predominant isoform expressed in mouse tissues and the human brain consists of 481 amino acids . Research indicates that C9ORF72 interacts with proteins involved in nucleocytoplasmic import, such as Importin b1 and Ran-GTPase, and regulates the formation and degradation of stress granules (SGs) . It is necessary for cellular recovery after stress removal and associates with p62 to target SGs for degradation via autophagy . C9ORF72 may also participate in chaperone-mediated autophagy through interaction with the cytosolic chaperone Hsc70 .

Expression and Localization

C9ORF72 transcripts are mainly expressed in myeloid cells, especially CD14+ monocytes in humans and mice, with elevated expression in dendritic and microglial cells . The protein has been found at the nuclear membrane and presynapses, as well as in association with lysosomes . C9ORF72 interacts with all members of the RAB3 protein family, suggesting a role in regulating synaptic vesicle functions, potentially by acting as a guanine nucleotide exchange factor for RAB3 proteins .

Role in Disease

A hexanucleotide repeat expansion in C9orf72 is the most common genetic cause of both frontotemporal dementia and amyotrophic lateral sclerosis . The pathogenic mechanisms of this mutation remain unresolved, though haploinsufficiency has been proposed as one potential mechanism . The expansion leads to reduced C9orf72 protein levels and gain-of-function effects from aggregating RNAs and DPRs .

Impact of C9orf72 Loss-of-Function

Studies using knockdown and knockout mouse models provide insights into the effects of C9orf72 loss-of-function .

ModelC9orf72 RNA ReductionProtein LevelPhenotype
Knockdown (KD)50–70%No decreaseNo behavioral or motor phenotypes; absence of TDP-43 pathology and p62 or ubiquitin aggregates
Knockout (KO)Not applicableDepletedImmune dysfunction (splenomegaly, enlarged lymph nodes, etc.) without motor neuron impairments or degeneration
Neuronal-Specific KONot applicableDepletedDecrease in body weight without motor impairment or decreased survival

Transcript and Protein Levels in ALS/FTD

Research has assessed C9orf72 transcript and protein levels in postmortem tissue from ALS/FTD patients and in patient-derived models .

Table 1: C9orf72 Transcript and Protein Levels in Postmortem Tissue

TissueTranscript Level ChangeProtein Level Change
Frontal Cortex~50% decrease25% decrease
Cerebellum~50% decreaseInconsistent

Table 2: C9orf72 Transcript and Protein Levels in Patient-Derived Models

ModelTranscript Level ChangeProtein Level Change
iPSC-derived neurons50% reductionDiscrepancies
Fibroblasts/iPSCsInconsistentReduced (fibroblasts)

These findings indicate that decreased C9orf72 transcript levels do not always correlate with decreased protein levels, and there are discrepancies between models . Issues with C9orf72 antibody specificity may contribute to these inconsistencies .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Repeated freeze-thaw cycles should be avoided.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TMEM252; C9orf71; Transmembrane protein 252
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-170
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMEM252
Target Protein Sequence
MQNRTGLILCALALLMGFLMVCLGAFFISWGSIFDCQGSLIAAYLLLPLGFVILLSGIFW SNYRQVTESKGVLRHMLRQHLAHGALPVATVDRPDFYPPAYEESLEVEKQSCPAEREASG IPPPLYTETGLEFQDGNDSHPEAPPSYRESIAGLVVTAISEDAQRRGQEC
Uniprot No.

Target Background

Database Links

HGNC: 28537

KEGG: hsa:169693

STRING: 9606.ENSP00000366528

UniGene: Hs.663056

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the normal cellular function of C9orf72 protein?

The C9orf72 protein functions primarily at lysosomes as part of a larger protein complex that also contains the Smith-Magenis Chromosome Region 8 (SMCR8) and WD repeat-containing protein 41 (WDR41) proteins. The major predicted structural feature of C9orf72 is a DENN (Differentially Expressed in Normal and Neoplastic cells) domain, suggesting it may act as a regulator of specific Rab GTPases. This function is supported by multiple studies showing defects in lysosome morphology and mTORC1 signaling arising from C9orf72 knockout in diverse model systems . The protein appears to be critical for normal lysosomal function, and its depletion can contribute to both physiological changes and disease pathology.

How do C9orf72 hexanucleotide repeat expansions contribute to neurodegeneration?

C9orf72 hexanucleotide repeat expansions contribute to neurodegeneration through three primary mechanisms:

  • DNA and RNA containing the hexanucleotide expansions fold into G quadruplex structures that sequester RNA binding proteins

  • RNA transcribed from the hexanucleotide expansions serves as a template for translation of dipeptide repeat (DPR) proteins in a non-ATG dependent manner. These DPR aggregates are found in the brains and spinal cords of ALS-FTD patients and exert deleterious effects

  • The expansions cause a reduction in C9orf72 mRNA levels, attributed to methylation of the locus, resulting in loss of the protein's normal function

The combination of toxic RNA gain-of-function, DPR toxicity, and loss of normal C9orf72 function collectively contributes to neurodegeneration.

What are the known C9orf72 haplotypes and their significance?

Several distinct C9orf72 haplotypes have been characterized in populations:

HaplotypeKey FeaturesSignificance
R haplotypeCharacterized by rs3849942G>A and other specific SNPsRisk haplotype found in all C9-ALS/FTD Caucasian patients
F haplotypeCommon non-R haplotypeFound in some patients as complementary allele
K haplotypeContains rs10757668 G>A substitution in 5' UTR of exon 2Common complementary non-R haplotype
P, N, J, Q haplotypesAdditional haplotypes in CaucasiansLess common variants
Z haplotypeCommon in China (>20%) and India (>10%)Potential Asian risk haplotype

The R haplotype is most frequently associated with 8 repeats in the normal range but shows the highest level of repeat length diversity . Interestingly, the expression of upstream promoter transcripts (V1 and V3) increases with hexanucleotide repeat length in the range of 2-30 repeats, suggesting functional consequences of repeat length even within the normal range .

How do different C9orf72 haplotypes affect gene expression and splicing efficiency?

Analysis of biallelic expression reveals that hexanucleotide repeat (HR) length significantly impacts C9orf72 expression patterns. The expression of upstream promoter transcripts (V1 and V3) positively correlates with HR length in the range of 2-30 repeats, with longer repeats associated with higher expression . This correlation is statistically significant and has been confirmed through direct comparison of alleles within the same genetic background.

Regarding splicing, pathological HR expansion reduces both first- and second-intron splicing efficiency and increases aberrant splicing at first-intron cryptic donor splice sites . This suggests that expansion-induced structural changes to the pre-mRNA may affect normal splicing patterns, potentially contributing to disease pathogenesis through altered isoform expression.

What are the current methodological approaches for studying C9orf72 repeat expansions?

Several methodological approaches are employed to study C9orf72 repeat expansions:

  • Haplotype Characterization:

    • Direct sequencing of PCR products along the C9orf72 locus

    • Deep sequencing to determine complete SNP compositions

    • Analysis of heterozygous SNPs to distinguish between alleles

  • Biallelic Expression Analysis:

    • Analysis of peak height ratios of alternative nucleotides at heterozygous SNP positions

    • RT-PCR with primers flanking specific exons

    • Quantification of variant-specific expression (V1, V2, V3)

  • Repeat Length Analysis:

    • PCR-based methods for normal-range repeats

    • Southern blot analysis for expanded repeats

    • Determination of repeat length ratios between alleles

  • Biomarker Development:

    • Neuropsychological tests

    • Imaging techniques

    • Electrophysiology

    • Analysis of specific dipeptide repeat proteins (e.g., poly glycine-proline) in cerebrospinal fluid as pharmacodynamic markers

These methods enable comprehensive characterization of C9orf72 variants, their expression patterns, and the effects of repeat expansions on cellular functions.

What cellular pathways are disrupted by C9orf72 mutations?

C9orf72 mutations disrupt several key cellular pathways:

  • Lysosomal Function: C9orf72 normally functions at lysosomes, and its depletion causes defects in lysosome morphology . This disruption affects cellular degradation processes and can lead to accumulation of toxic proteins.

  • mTORC1 Signaling: C9orf72 knockout results in altered mTORC1 signaling, which regulates protein synthesis, cell growth, and autophagy . Disruption of this pathway can impact cellular homeostasis and stress responses.

  • Autophagy: As part of its role in lysosomal function, C9orf72 appears to regulate autophagy. Reduced C9orf72 levels may impair autophagy, contributing to neurodegeneration through failure to clear protein aggregates .

  • RNA Processing: The hexanucleotide expansions lead to formation of RNA foci that sequester RNA-binding proteins, disrupting normal RNA processing throughout the cell .

  • Protein Translation: The non-ATG-dependent translation of dipeptide repeat proteins from expansion-containing transcripts introduces toxic protein species that can interfere with multiple cellular functions, including nucleocytoplasmic transport .

Understanding these disrupted pathways provides potential therapeutic targets for intervention in C9orf72-associated diseases.

How can researchers effectively model C9orf72-related diseases in laboratory settings?

Effective modeling of C9orf72-related diseases requires consideration of multiple approaches:

  • Animal Models:

    • Transgenic mice expressing human C9orf72 with expanded repeats

    • C9orf72 knockout models to study loss-of-function effects

    • Note: Current C9orf72 animal models lack some key features of the disease, such as reduced survival and neuromuscular decline, but can recapitulate the molecular signature including RNA foci and dipeptide repeat proteins

  • Cellular Models:

    • Patient-derived induced pluripotent stem cells (iPSCs) differentiated into neurons

    • CRISPR-engineered cell lines with specific C9orf72 mutations

    • Primary cell cultures from C9orf72 model organisms

  • Molecular Readouts:

    • Accumulation of repeat-containing transcripts

    • Presence of RNA foci

    • Production and aggregation of dipeptide repeat proteins

    • Analysis of splicing patterns and variant expression

    • Assessment of lysosomal function and morphology

For therapeutic development, these models have been valuable in testing approaches like antisense oligonucleotides (ASOs) that target repeat-containing transcripts. The molecular signature of the disease serves as useful therapeutic readouts in both preclinical studies and clinical trials .

What techniques are used to measure C9orf72 protein levels and activity in experimental systems?

Several techniques are employed to measure C9orf72 protein levels and activity:

  • Protein Quantification:

    • Western blotting with C9orf72-specific antibodies

    • Immunoprecipitation followed by mass spectrometry

    • ELISA-based detection systems

  • Localization and Interaction Studies:

    • Immunofluorescence to determine subcellular localization

    • Proximity ligation assays to detect interactions with SMCR8 and WDR41

    • Co-immunoprecipitation to identify binding partners

    • Bimolecular fluorescence complementation (BiFC) to visualize protein interactions in living cells

  • Functional Assays:

    • Lysosomal function assessment through LysoTracker staining

    • Analysis of mTORC1 pathway activation via phosphorylation of S6K and 4E-BP1

    • Autophagy flux measurement using LC3-II/LC3-I ratio and p62 levels

    • Analysis of Rab GTPase activity in the presence/absence of C9orf72

  • Expression Analysis:

    • RT-PCR to quantify different transcript variants (V1, V2, V3)

    • Analysis of allele-specific expression using heterozygous SNPs

    • RNA-seq to determine global expression changes

These techniques collectively provide comprehensive assessment of C9orf72 levels, localization, interaction networks, and functional impact in experimental systems.

How can researchers distinguish between the three proposed disease mechanisms in C9orf72-related disorders?

Distinguishing between the three proposed disease mechanisms (RNA toxicity, DPR toxicity, and loss of function) requires carefully designed experiments:

  • RNA Toxicity Assessment:

    • FISH (Fluorescence In Situ Hybridization) to visualize RNA foci

    • RNA pulldown assays to identify sequestered RNA-binding proteins

    • RNA structure analysis to characterize G-quadruplexes

    • Transcriptome analysis to identify dysregulated RNA processing

  • DPR Toxicity Evaluation:

    • Immunohistochemistry with DPR-specific antibodies

    • Quantification of poly GP in cerebrospinal fluid as a pharmacodynamic marker

    • Expression of individual DPR proteins to determine specific toxicity mechanisms

    • Proteomic analysis to identify DPR-interacting proteins

  • Loss-of-Function Studies:

    • C9orf72 knockdown or knockout models

    • Rescue experiments with wild-type C9orf72

    • Analysis of lysosomal function and morphology

    • Assessment of mTORC1 signaling pathway

  • Comparative Analysis:

    • Models expressing expanded repeats but preventing DPR translation

    • Models expressing DPRs without expanded RNA

    • Models with C9orf72 loss of function but without expanded repeats

These approaches allow researchers to dissect the relative contributions of each mechanism to disease pathogenesis, which is crucial for developing targeted therapeutic strategies.

What therapeutic strategies are being developed for C9orf72-related disorders?

Several therapeutic strategies are in development for C9orf72-related disorders:

  • Antisense Oligonucleotides (ASOs):

    • BIIB078 (IONIS-C9Rx) is being tested in a Phase 1 clinical trial (NCT03626012)

    • Designed to selectively target expansion-containing C9orf72 transcripts

    • Reduces repeat-containing RNA levels and decreases both soluble and insoluble DPR proteins

    • Shown to attenuate behavioral deficits in transgenic mice

  • Stereopure ASOs:

    • WVE-004 (Wave Life Science) is being tested in a Phase 1b/2a clinical trial (FOCUS-C9, NCT04931862)

    • Selectively reduces repeat-containing variants of C9orf72 in cellular and mouse models

    • Utilizes stabilized chemistry for improved efficacy

  • Small Molecules:

    • Compounds targeting G-quadruplex structures formed by repeat expansions

    • Molecules interfering with RAN translation to prevent DPR production

    • Drugs enhancing autophagy to clear toxic protein aggregates

  • Gene Therapy:

    • Viral delivery of C9orf72 to restore normal protein function

    • CRISPR-based approaches to correct or inactivate the expanded repeat

  • Combination Therapies:

    • Approaches targeting multiple disease mechanisms simultaneously

    • Combinations of ASOs with small molecules affecting downstream pathways

The most advanced therapies currently in clinical trials are ASO-based approaches that selectively target repeat-containing C9orf72 transcripts without significantly affecting normal C9orf72 expression .

What biomarkers are available for monitoring C9orf72-targeted therapies?

Several biomarkers are being developed and utilized for monitoring C9orf72-targeted therapies:

  • Molecular Biomarkers:

    • Poly glycine-proline (GP) dipeptide repeat proteins in cerebrospinal fluid serve as pharmacodynamic markers for ASO therapy

    • Levels of repeat-containing RNA transcripts

    • C9orf72 protein levels in accessible tissues

    • RNA foci quantification in patient-derived cells

  • Neuroimaging Biomarkers:

    • Structural MRI to assess brain volume and atrophy

    • Functional MRI to evaluate brain activity patterns

    • PET imaging with specialized tracers for neuroinflammation or protein aggregates

  • Electrophysiological Biomarkers:

    • Electromyography (EMG) for motor neuron function

    • Electroencephalography (EEG) for brain activity assessment

    • Nerve conduction studies to evaluate peripheral nerve function

  • Clinical Functional Assessments:

    • ALS Functional Rating Scale-Revised (ALSFRS-R)

    • Neuropsychological test batteries for cognitive function

    • Quality of life measures specifically validated for ALS and FTD patients

These biomarkers are essential for establishing target engagement, evaluating efficacy, and determining optimal dosing in clinical trials. The development of poly GP measurement in cerebrospinal fluid represents a significant advance as it directly reflects target engagement of therapies designed to reduce repeat-containing transcripts .

Why do C9orf72 mutations result in different clinical presentations (ALS, FTD, or both)?

The variable clinical presentation of C9orf72 mutations remains one of the central mysteries in the field. Several factors may contribute to this clinical heterogeneity:

  • Genetic Modifiers:

    • Different C9orf72 haplotypes may influence disease presentation

    • Additional genetic variants in other genes likely modify disease pathways

    • Repeat length variability between tissues could influence regional vulnerability

  • Cellular and Molecular Factors:

    • Cell-type specific vulnerability to different disease mechanisms

    • Variations in C9orf72 splicing efficiency between brain regions

    • Differential expression of interacting proteins across neuronal populations

    • Non-neuronal cells may respond differently to the mutation and contribute differentially to neurodegeneration in the frontal cortex versus the spinal cord

  • Environmental and Developmental Factors:

    • Lifetime environmental exposures that affect specific neuronal populations

    • Age-related changes in proteostasis and stress response pathways

    • Developmental differences in C9orf72 expression patterns

  • Disease Progression Factors:

    • The timing of molecular and cellular changes preceding symptoms

    • How early these changes occur before clinical presentation

    • Spread of pathology through anatomically connected regions

Research continues to explore these factors, with the 2023 scientific meeting on C9orf72 highlighting that understanding the basis for differential clinical presentation remains one of the field's central questions . Ongoing work is examining whether contributions from non-neuronal cells differ between brain regions affected in FTD and those affected in ALS, potentially explaining the divergent clinical manifestations.

What are the current knowledge gaps in C9orf72 research?

Despite significant advances, several knowledge gaps remain in C9orf72 research:

  • Phenotypic Variability:

    • Why do some people with C9orf72 mutations develop only ALS, some only FTD, and others both conditions?

    • What molecular and cellular changes precede symptoms, and how early do they occur?

  • Non-neuronal Contributions:

    • How do non-neuronal cells respond to the mutation and contribute to neurodegeneration?

    • Do these contributions differ between the brain's frontal cortex and the spinal cord?

  • Therapeutic Targets:

    • What are the direct physiological targets for C9orf72 at lysosomes?

    • Which disease mechanism (RNA toxicity, DPR toxicity, or loss of function) should be prioritized for therapeutic intervention?

  • Molecular Mechanisms:

    • How exactly does C9orf72 regulate lysosome function?

    • What is the significance of the various C9orf72 transcript variants and their differential regulation?

  • Biomarkers and Disease Progression:

    • What biomarkers can predict disease onset in asymptomatic C9orf72 mutation carriers?

    • What factors determine the rate of disease progression in affected individuals?

Addressing these knowledge gaps is crucial for developing effective therapeutic strategies and potentially preventing disease onset in those at genetic risk.

How can collaborative research initiatives advance C9orf72 understanding?

Collaborative research initiatives can significantly advance C9orf72 understanding through several approaches:

  • Multidisciplinary Summits:

    • Bringing together physicians and scientists to brainstorm on how two distinct diseases (ALS and FTD) are driven by one genetic mutation

    • Facilitating discussions on disease mechanisms, novel biomarkers, therapeutic approaches, and clinical trial designs specific to C9orf72

  • Data Sharing Platforms:

    • Establishing repositories for C9orf72 patient data, including clinical information, genetic data, and biospecimens

    • Creating open-access databases of experimental results from various model systems

    • Developing standardized protocols for C9orf72 research to enable cross-laboratory validation

  • Collaborative Clinical Trials:

    • Designing multisite trials with standardized outcome measures

    • Implementing adaptive trial designs that can efficiently test multiple therapeutic approaches

    • Establishing networks for rapid recruitment of C9orf72 mutation carriers

  • Cross-disciplinary Approaches:

    • Integrating expertise from neurology, genetics, cell biology, structural biology, and computational science

    • Applying systems biology approaches to understand the complex network effects of C9orf72 mutations

    • Developing novel technologies specifically tailored to C9orf72 research challenges

The 2023 scientific meeting on C9orf72 demonstrated the value of such collaborations, with participants noting that sharing diverse perspectives created momentum in the C9orf72 community and laid the groundwork for continued complementary discussions beyond the summit . A follow-up meeting is already scheduled for 2025 to evaluate progress and share impacts on C9orf72 research and patient care.

What novel experimental approaches might reveal new insights into C9orf72 function and pathology?

Several novel experimental approaches show promise for revealing new insights into C9orf72 function and pathology:

  • Single-cell Technologies:

    • Single-cell RNA sequencing to identify cell type-specific responses to C9orf72 mutations

    • Single-cell proteomics to detect rare protein species and cell-to-cell variability

    • Spatial transcriptomics to map gene expression changes across brain regions affected by C9orf72 mutations

  • Advanced Imaging Techniques:

    • Super-resolution microscopy to visualize C9orf72 protein interactions at lysosomes

    • Live-cell imaging of RNA foci formation and dynamics

    • Cryo-electron microscopy to determine the structure of the C9orf72-SMCR8-WDR41 complex

  • Humanized Models:

    • Brain organoids derived from C9orf72 mutation carriers

    • Humanized mouse models expressing the complete human C9orf72 locus

    • Chimeric models combining human and mouse cells to study non-cell-autonomous effects

  • Computational Approaches:

    • Machine learning algorithms to predict disease onset and progression

    • Network analysis to identify key nodes in C9orf72-related pathways

    • In silico screening for compounds that might stabilize C9orf72 protein function

  • Novel Therapeutic Platforms:

    • RNA-targeting CRISPR systems to selectively modify repeat-containing transcripts

    • Nanobodies targeting specific conformations of C9orf72 or its interacting partners

    • Exosome-based delivery systems for targeting therapeutics to specific cell types

These cutting-edge approaches have the potential to address current knowledge gaps and accelerate the development of effective therapies for C9orf72-related disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.