Recombinant Human Transmembrane protein FLJ23183

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to ensure contents settle. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-168
Protein Length
full length protein
Target Protein Sequence
MPKGWGVRSSTFLPLWLPVKIELHQVQFHSSSQMIFSTLRSELYKLLALCQHAVVPMGKF LGKTKTQPQGQVVIFSEKGKAIIYLSLPRTVPIYTCIFSQSVGCLFILLIISFNFLLFIY FIETDLIMLPRVILDLLASSDPPTFVSQSAGITDVNYHTQSTCRRFSV
Uniprot No.

Q&A

What is Recombinant Human Transmembrane protein FLJ23183?

Recombinant Human Transmembrane protein FLJ23183 (Q9H5Q3.1) is a full-length protein spanning positions 1-168 amino acids. It is produced using a cell-free expression system, which allows for the expression of potentially difficult membrane proteins without cellular limitations. The protein is typically supplied in liquid form containing glycerol with a purity of greater than or equal to 85% as determined by SDS-PAGE analysis .

What are the optimal storage conditions for recombinant FLJ23183?

For long-term storage, Recombinant Human Transmembrane protein FLJ23183 should be stored at -20°C or -80°C. For working with the protein, it is recommended to prepare aliquots to avoid repeated freeze-thaw cycles, which can compromise protein integrity. Working aliquots can be stored at 4°C for up to one week. The protein is typically shipped and stored in a buffer containing glycerol for stability .

How should researchers prepare the protein for experimental use?

When preparing FLJ23183 for experiments, researchers should:

  • Thaw the protein aliquot on ice

  • Briefly centrifuge the vial if liquid becomes entrapped in the container's cap

  • Maintain appropriate temperature conditions during handling

  • Consider the buffer composition when designing experiments to ensure compatibility with your experimental system

If needed, the protein can be diluted in a buffer compatible with your experimental requirements, though buffer exchange should be minimized to avoid protein loss or denaturation .

How should I design experiments to study FLJ23183 function?

When designing experiments to study FLJ23183 function, follow these systematic steps:

  • Define your specific variables: Clearly identify your independent variables (what you will manipulate) and dependent variables (what you will measure) related to FLJ23183 function

  • Formulate a testable hypothesis about FLJ23183's role or activity

  • Design appropriate experimental treatments and controls

  • Determine whether a between-subjects or within-subjects approach is most suitable

  • Plan precise measurements of your dependent variables

What are appropriate controls when working with recombinant transmembrane proteins?

When working with recombinant transmembrane proteins like FLJ23183, consider including these controls:

  • Negative controls: Buffer-only conditions without the recombinant protein

  • Positive controls: Well-characterized transmembrane proteins with known activities

  • Denatured protein controls: Heat-inactivated FLJ23183 to distinguish between specific and non-specific effects

  • Tag-only controls: If your FLJ23183 contains tags (like His-tags), include a control with just the tag to ensure observed effects are not due to the tag

  • Concentration gradients: Multiple concentrations of FLJ23183 to establish dose-dependent relationships

What techniques are effective for studying transmembrane protein structure and interactions?

For studying the structure and interactions of transmembrane proteins like FLJ23183, consider these approaches:

  • Structural analysis:

    • X-ray crystallography (challenging but informative)

    • Cryo-electron microscopy

    • NMR for specific domains

  • Interaction studies:

    • Co-immunoprecipitation

    • Proximity ligation assays

    • Förster resonance energy transfer (FRET)

    • Bioluminescence resonance energy transfer (BRET)

    • Surface plasmon resonance (SPR)

  • Cellular localization:

    • Immunofluorescence microscopy

    • Subcellular fractionation

For transmembrane proteins, investigating both cis interactions (between receptors on the same cell) and trans interactions (between receptors on different cells) may be important, as seen with other membrane proteins .

How can I assess FLJ23183 integration into artificial membrane systems?

To assess FLJ23183 integration into artificial membrane systems:

  • Liposome reconstitution: Incorporate the protein into liposomes and verify incorporation using:

    • Sucrose density gradient centrifugation

    • Protease protection assays

    • Fluorescence microscopy with labeled protein

  • Nanodiscs: Assemble FLJ23183 into nanodiscs with membrane scaffold proteins and verify using:

    • Size exclusion chromatography

    • Transmission electron microscopy

    • Functional assays specific to transmembrane proteins

  • Planar lipid bilayers: Incorporate FLJ23183 and measure:

    • Electrical properties using patch-clamp techniques if applicable

    • Protein lateral diffusion using fluorescence recovery after photobleaching (FRAP)

How can structural insights inform the study of FLJ23183 signaling mechanisms?

Understanding the structural aspects of FLJ23183 can significantly inform its signaling mechanisms:

  • Like other transmembrane proteins, FLJ23183 may undergo conformational changes upon ligand binding or other stimuli. Structural studies can help identify:

    • Potential binding domains

    • Conformational changes associated with activation

    • Interaction interfaces with other proteins or receptors

  • Similar to plexin receptors, FLJ23183 may exist in autoinhibited states that regulate signaling. Structural analysis might reveal:

    • Potential cis-dimerization or homo/hetero-oligomerization

    • Regulatory regions that maintain inactive conformations

    • Structural changes that occur during activation

  • Comparative structural analysis with other transmembrane proteins like FLRT3 can provide insights into conserved signaling mechanisms and domain functions .

What approaches are recommended for studying potential roles of FLJ23183 in cell-cell communication?

To investigate FLJ23183's potential roles in cell-cell communication:

  • Cell adhesion assays:

    • Aggregation assays with cells expressing FLJ23183

    • Cell sorting assays to identify preferential interactions

    • Quantitative adhesion force measurements

  • Functional studies:

    • Co-culture systems with cells expressing FLJ23183 and potential interaction partners

    • Time-lapse microscopy to observe dynamic interactions

    • Knockdown/knockout studies to assess phenotypic consequences

  • Signaling pathway analysis:

    • Phosphorylation studies to identify downstream signaling events

    • Transcriptional profiling to identify regulated genes

    • Calcium imaging or other second messenger assays

Learning from studies of similar proteins like FLRT3, which has established roles in cell adhesion, migration, and axon guidance through both homotypic and heterotypic interactions, may provide valuable experimental paradigms .

What are common challenges when working with recombinant transmembrane proteins and how can they be addressed?

Working with transmembrane proteins presents several challenges:

ChallengeSolution Approaches
Low protein solubility- Use carrier-free preparations when possible
- Optimize detergent/lipid composition
- Consider protein fusion tags that improve solubility
- Use cell-free expression systems for difficult proteins
Protein aggregation- Carefully control temperature during handling
- Optimize buffer conditions (pH, salt concentration)
- Include glycerol or other stabilizing agents
- Use size exclusion chromatography to remove aggregates
Poor functional activity- Verify proper folding using circular dichroism
- Ensure appropriate post-translational modifications
- Consider the addition of specific lipids required for function
- Test multiple reconstitution protocols
Non-specific binding- Include blocking agents in binding assays
- Perform stringent washing steps
- Include appropriate controls to distinguish specific from non-specific interactions

For FLJ23183 specifically, its status as a cell-free expressed protein may alleviate some issues but require special attention to proper folding and functional verification .

How can I validate antibodies against FLJ23183 for research applications?

To validate antibodies against FLJ23183:

  • Specificity testing:

    • Western blotting with recombinant FLJ23183 protein

    • Testing in cells with endogenous expression versus knockout/knockdown cells

    • Peptide competition assays

    • Testing cross-reactivity with related proteins

  • Application-specific validation:

    • For immunoprecipitation: verify pull-down of specifically sized bands

    • For immunohistochemistry: compare with in situ hybridization patterns

    • For flow cytometry: compare with isotype controls and blocking experiments

  • Reproducibility assessment:

    • Test multiple antibody lots

    • Compare results across different cell types or tissues

    • Validate findings using alternative antibodies against different epitopes

Document all validation steps methodically, as antibody validation is critical for ensuring reliable research outcomes with transmembrane proteins like FLJ23183 .

What are promising approaches for identifying potential binding partners of FLJ23183?

To identify potential binding partners of FLJ23183, consider these approaches:

  • Proximity-based methods:

    • BioID or TurboID proximity labeling

    • APEX2 proximity labeling

    • Cross-linking mass spectrometry (XL-MS)

  • Affinity-based methods:

    • Pull-down assays with purified FLJ23183

    • Yeast two-hybrid screening (for soluble domains)

    • Protein arrays or peptide arrays

  • Functional genomics approaches:

    • CRISPR screens to identify genes affecting FLJ23183 function

    • Synthetic genetic array analysis

    • Transcriptional profiling following FLJ23183 modulation

  • Computational predictions:

    • Homology-based partner prediction

    • Structural docking simulations

    • Co-expression network analysis

Drawing parallels from studies of FLRT3, which has established interactions with FGF receptors and roles in cell adhesion, may provide valuable insights for investigating FLJ23183 binding partners .

How might single-cell techniques advance our understanding of FLJ23183 function?

Single-cell techniques offer powerful approaches to understand FLJ23183 function:

  • Single-cell transcriptomics:

    • Identify cell populations expressing FLJ23183

    • Correlate FLJ23183 expression with specific cellular states

    • Map co-expression patterns to infer function

  • Single-cell proteomics:

    • Quantify FLJ23183 protein levels in individual cells

    • Measure post-translational modifications

    • Correlate with cellular phenotypes

  • Advanced imaging techniques:

    • Live-cell imaging of fluorescently tagged FLJ23183

    • Single-molecule tracking to analyze dynamics

    • Super-resolution microscopy to visualize subcellular localization

    • FRET-FLIM to detect protein-protein interactions in situ

  • Functional single-cell assays:

    • Patch-clamp recording if FLJ23183 affects electrical properties

    • Calcium imaging to detect signaling events

    • Force measurements for adhesion properties

These approaches can reveal heterogeneity in FLJ23183 expression and function across cell populations that might be masked in bulk analyses .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.