Recombinant Human Transmembrane protein FLJ37396

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. If a specific tag is required, please inform us to prioritize its inclusion.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-592
Protein Length
full length protein
Target Protein Sequence
MDPLPYHKGRRPVRQPSVSRALAQCPGRIGSHAGLKDECKVHSVQFMEFSEVENQDDYYS TEAGCIHTQDQQGVHVMYEEALSDLKELEAELLLVASHYIEKERGHKVGSQPKSGQEWGW AHADVDRFAVLYDTWTWEAALLENKRQLLDSYFEAYQHTLDPEERFTLAQVMTDIVHRRP RFDLSHPYFIKAYQEECTCLRLHLQLVRGILNQQIERQREYVQRLWREDHLDNSNTFGLP LNIVCKQLISINNSCPASKNVYLLEFHPSLSLAALIPKALEHLFQEACHACRPTSASGLA SLERHVLQLALDLWLTPATPEAWYSTQLQKDLFSAKVMGDPFLVGEIGLLAFKSAADEGQ KQDQDSHVLLLEMFSKLLELLTLRHRLIEMSLESAHLARLYKELAWEMGFEEFHLYLRPV HFEFASHGDRADQPPPVFITSLLEDSGRVDRYSPTALVLAISEVDDNQIGKFSFYTKEAI LKLLLHSGVENMQVTLACQAAQKNALMAAVQQVYFYCTPQGSCPANVKVSLHDREARGIS SPPPANVRLPLSSFLFSLLPFSLSFSPAPYFLFPISLSSLLSFFLPFLVSCL
Uniprot No.

Q&A

What purification strategies provide optimal yield and purity for FLJ37396?

Purification of transmembrane proteins like FLJ37396 requires careful optimization to maintain protein integrity while achieving high purity. A multi-step approach is recommended, beginning with cell disruption using detergent solubilization (typically with mild detergents like DDM or LMNG). Following initial extraction, affinity chromatography utilizing the C-terminal His-tag commonly engineered into recombinant constructs allows for efficient capture . For analytical work requiring higher purity, size exclusion chromatography (SEC) provides further purification while simultaneously confirming protein oligomeric state. Protein quality should be assessed using SDS-PAGE, Western blotting, and functional assays specific to transmembrane proteins. Throughout the purification process, it's critical to maintain the cold chain (4°C) and include protease inhibitors to prevent degradation of this potentially labile membrane protein.

How can I assess the integrity and proper folding of purified FLJ37396?

Assessing integrity and proper folding of transmembrane proteins requires multiple complementary approaches. For FLJ37396, researchers should employ:

  • Biophysical characterization: Circular dichroism (CD) spectroscopy can confirm secondary structure content, particularly the alpha-helical structures typical of transmembrane domains.

  • Size and homogeneity analysis: Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) can verify the oligomeric state and homogeneity of the preparation.

  • Thermal stability assessment: Differential scanning fluorimetry (DSF) or nanoDSF can evaluate protein stability under various buffer conditions.

  • Functional validation: Activity assays specific to the predicted function of FLJ37396 should be developed and optimized.

For transmembrane proteins, proper folding is often assessed by monitoring the protein's ability to insert correctly into liposomes or nanodiscs, which can be verified using electron microscopy techniques similar to those employed for other designed transmembrane proteins .

What structural prediction methods are most reliable for understanding FLJ37396 topology?

Transmembrane protein structure prediction for proteins like FLJ37396 has evolved significantly with recent advances in computational biology. The most reliable current approaches combine:

  • Machine learning methods: AlphaFold2 and RoseTTAFold have demonstrated remarkable accuracy in predicting transmembrane protein structures, including novel folds.

  • Transmembrane-specific predictors: TMHMM, Phobius, and TOPCONS should be employed specifically for transmembrane helix prediction and topology analysis.

  • Evolutionary analysis: Multiple sequence alignment across species can identify conserved regions likely critical for structure and function.

  • Integrative approaches: Combining experimental data (such as limited proteolysis or cysteine accessibility) with computational predictions significantly increases reliability.

When analyzing FLJ37396, researchers should compare predictions from multiple algorithms to identify consensus regions. Special attention should be paid to charged residues within predicted transmembrane segments, as these often play crucial roles in function or assembly. The methodologies successfully employed in de novo transmembrane protein design studies demonstrate that computational approaches can accurately predict structural features of membrane proteins .

How can I experimentally determine the oligomeric state of FLJ37396 in membrane environments?

Determining the oligomeric state of transmembrane proteins like FLJ37396 in native-like membrane environments requires specialized techniques:

  • Cryo-electron microscopy (cryo-EM): For direct structural visualization of the protein in detergent micelles or membrane mimetics, as successfully employed for designed transmembrane pores .

  • Chemical crosslinking coupled with mass spectrometry: This approach can capture and identify protein-protein interactions within the membrane.

  • FRET-based assays: Using fluorescently labeled protein constructs to detect proximity between subunits.

  • Native gel electrophoresis: Blue native PAGE with mild detergents can preserve native oligomeric assemblies.

  • Analytical ultracentrifugation: When adapted for membrane proteins in detergent, this technique provides valuable information about oligomerization.

For most accurate results, researchers should employ multiple complementary methods. Cross-validation between different techniques is essential due to the potential for detergent effects on oligomerization state. When preparing samples for these analyses, it's critical to ensure the protein remains in a native-like lipid or detergent environment throughout.

What methodologies are recommended for studying ion conductance properties of FLJ37396?

If FLJ37396 is suspected to have ion channel or pore-forming capabilities (like other transmembrane proteins), several methodologies can characterize its ion conductance properties:

  • Patch-clamp electrophysiology: Whole-cell patch clamping using transfected cells (typically HEK293 or similar) expressing FLJ37396 can reveal conductance properties and ion selectivity, as demonstrated for designed transmembrane pores .

  • Planar lipid bilayer recordings: This cell-free system allows precise control of buffer conditions on both sides of the membrane, enabling detailed ion selectivity studies.

  • Ion flux assays: Fluorescence-based methods using ion-sensitive dyes in proteoliposomes can provide higher-throughput data.

  • Mutagenesis studies: Strategic mutations of charged residues (especially glutamate and aspartate) in predicted pore regions can help identify key sites for ion selectivity, similar to the E44F mutation studies performed on designed transmembrane pores that demonstrated the importance of charged residues at pore entrances .

When conducting these experiments, researchers should systematically test different ionic conditions (varying both cation types and concentrations) to establish selectivity profiles. For mammalian expression systems, the use of HEK293S GnTi- cells can provide advantages for electrophysiological studies due to their consistent glycosylation patterns .

How can I establish a cellular model system to study FLJ37396 function in physiologically relevant contexts?

Establishing a cellular model system for FLJ37396 requires careful consideration of cellular context and expression levels:

  • Cell line selection: Choose cell lines relevant to the physiological context where FLJ37396 is normally expressed. If this information is limited, common mammalian expression systems like HEK293 or CHO cells provide a good starting point.

  • Expression strategy optimization: For transient expression, the baculovirus-mammalian cell (BacMam) system offers advantages of high efficiency and controllable expression levels . For stable expression, lentiviral or piggyBac transposon systems may be preferable.

  • Inducible expression systems: Tetracycline-inducible systems allow titration of expression levels, which is especially important for transmembrane proteins that may cause toxicity when overexpressed.

  • Fluorescent tagging strategies: C-terminal tags are generally preferable for transmembrane proteins to avoid disrupting signal peptides, but verification of proper localization is essential.

What approaches can be used to identify interaction partners of FLJ37396?

Identifying interaction partners of transmembrane proteins presents unique challenges that require specialized techniques:

  • Proximity-based labeling: BioID or APEX2 fusions to FLJ37396 can biotinylate proximal proteins in living cells, allowing subsequent purification and mass spectrometry identification.

  • Crosslinking mass spectrometry: Chemical crosslinkers that preserve membrane protein interactions before solubilization can capture transient or weak interactions.

  • Co-immunoprecipitation with membrane-compatible detergents: Mild detergents like digitonin or LMNG better preserve protein-protein interactions compared to harsher detergents.

  • Membrane yeast two-hybrid systems: Specialized Y2H systems designed for membrane proteins can identify binary interactions.

  • Functional genomics approaches: CRISPR screens in cells expressing FLJ37396 can identify genes that modulate its function through direct or indirect interactions.

When analyzing potential interaction partners, researchers should prioritize hits found across multiple methods. Validation of key interactions should be performed using reciprocal co-immunoprecipitation and co-localization studies. For membrane proteins like FLJ37396, careful consideration of the membrane environment is crucial—interactions may be dependent on specific lipids or membrane compartments.

How can reconstitution systems be used to study the biophysical properties of FLJ37396?

Reconstitution of transmembrane proteins into artificial membrane systems provides powerful approaches for biophysical characterization:

  • Proteoliposome preparation: Purified FLJ37396 can be incorporated into liposomes of defined lipid composition, allowing controlled studies of transport or pore formation, similar to the approaches used for designed transmembrane pores .

  • Nanodiscs: These provide a more stable and monodisperse system compared to liposomes, with better control over protein orientation and lipid composition.

  • Planar supported bilayers: Allow for surface-sensitive techniques like surface plasmon resonance (SPR) or atomic force microscopy (AFM).

  • Fluorescence-based assays: Reconstituted systems can be used with fluorescent dyes to monitor transport, as demonstrated for size-dependent dye uptake in proteoliposomes containing designed transmembrane pores .

The choice of lipid composition is critical and should reflect the native environment of FLJ37396. For initial studies, a mixture of POPC:POPE:POPG (3:1:1) provides a reasonable starting point. Functional assays in these reconstituted systems should include appropriate controls such as empty liposomes and liposomes containing well-characterized channel proteins (e.g., α-hemolysin) for comparison .

What strategies can overcome low expression yields of FLJ37396 in recombinant systems?

Low expression yields of transmembrane proteins like FLJ37396 can be addressed through several optimization strategies:

For each optimization step, small-scale expression tests should be performed before scaling up. When using the BacMam system, it's critical to optimize both the baculovirus generation in Sf9 cells and the subsequent transduction of mammalian cells, as protocols for these steps significantly impact final protein yields .

How can I overcome aggregation issues during purification of FLJ37396?

Aggregation is a common challenge when working with transmembrane proteins like FLJ37396. These strategies can help:

  • Detergent optimization:

    • Screen multiple detergents (DDM, LMNG, GDN, etc.) for extraction efficiency and protein stability

    • Consider detergent mixtures that can better mimic native lipid environments

    • Use systematic detergent screening approaches with stability assays

  • Buffer optimization:

    • Test different pH values within the physiological range

    • Add stabilizing agents (glycerol, specific lipids, cholesterol)

    • Include specific additives like cholesteryl hemisuccinate for mammalian membrane proteins

  • Purification protocol adjustments:

    • Maintain consistent cold temperature throughout purification

    • Minimize concentration steps that can promote aggregation

    • Consider on-column detergent exchange during affinity purification

  • Alternative solubilization approaches:

    • Styrene maleic acid lipid particles (SMALPs) to extract proteins with surrounding lipids

    • Amphipol exchange for improved stability after initial detergent extraction

    • Reconstitution into nanodiscs at an early purification stage

Analytical techniques like dynamic light scattering and size exclusion chromatography should be used throughout the optimization process to monitor aggregation. When analyzing SEC profiles, attention should be paid to the void volume peak, which typically indicates aggregation. For particularly challenging proteins, the addition of specific lipids from the native membrane environment can significantly improve stability during purification .

What controls are essential when validating antibodies for studying endogenous FLJ37396?

Rigorous validation of antibodies is critical for transmembrane protein research, as these proteins often present unique challenges for antibody specificity:

  • Essential negative controls:

    • Knockout or knockdown cell lines lacking FLJ37396 expression

    • Pre-absorption of the antibody with purified antigen

    • Secondary antibody-only controls to assess non-specific binding

  • Positive controls:

    • Cells overexpressing tagged FLJ37396 (with tag detection in parallel)

    • Tissues known to express high levels of the target protein

    • Purified recombinant protein as a Western blot standard

  • Cross-validation approaches:

    • Compare results from multiple antibodies targeting different epitopes

    • Verify signal correlation between antibody detection and mRNA expression

    • Confirm specificity using orthogonal methods (e.g., mass spectrometry)

  • Application-specific validation:

    • For immunofluorescence: Compare patterns with fluorescently tagged proteins

    • For Western blotting: Verify band migration pattern matches predicted MW

    • For immunoprecipitation: Confirm pulled-down protein by mass spectrometry

When working with transmembrane proteins like FLJ37396, epitope accessibility can vary dramatically between applications due to detergent effects, fixation methods, or conformational changes. Therefore, antibodies should be validated separately for each experimental application (Western blot, immunofluorescence, immunoprecipitation, etc.) with appropriate positive and negative controls for each technique.

How does FLJ37396 compare structurally and functionally to better-characterized transmembrane proteins?

Comparative analysis of FLJ37396 with well-characterized transmembrane proteins can provide valuable insights:

  • Structural comparison approaches:

    • Threading models against known transmembrane protein structures

    • Analysis of predicted transmembrane helices for conserved motifs (e.g., GxxxG dimerization motifs)

    • Comparison with designed transmembrane pores that have defined structural characteristics

  • Functional comparison methods:

    • Assess ion conductance properties in comparison to characterized channels

    • Compare substrate specificity profiles if transport function is suspected

    • Evaluate size-dependent permeability similar to analyses performed for designed pores

  • Domain architecture analysis:

    • Compare with domain structures of proteins like FLRT2 that contain specific extracellular motifs such as leucine-rich repeats and fibronectin domains

    • Identify any conserved intracellular signaling domains

  • Phylogenetic profiling:

    • Determine evolutionary relationships to proteins with known functions

    • Identify co-evolution with potential interaction partners

When conducting these comparisons, researchers should be particularly attentive to conserved charged residues within transmembrane regions, as these often play critical roles in ion selectivity or transport function, as demonstrated in designed transmembrane pores where specific glutamate residues significantly impact conductance properties .

What evolutionary insights can be gained from studying FLJ37396 orthologs across species?

Evolutionary analysis of FLJ37396 can provide significant insights into its function and importance:

  • Conservation pattern analysis:

    • Determine whether the protein is widely conserved (suggesting fundamental functions) or narrowly distributed (suggesting specialized roles)

    • Identify regions of high conservation that likely represent functional domains

    • Compare conservation patterns with well-characterized transmembrane proteins like FLRT2, which shares 95-99% sequence identity in its extracellular domain across mammalian species

  • Synteny analysis:

    • Examine gene neighborhood conservation across species

    • Identify co-evolved gene clusters that may suggest functional relationships

  • Evolutionary rate analysis:

    • Calculate dN/dS ratios to identify regions under positive or purifying selection

    • Compare evolutionary rates with related proteins to identify functional shifts

  • Domain gain/loss patterns:

    • Identify lineage-specific additions or losses of protein domains

    • Determine whether transmembrane topology is conserved across orthologs

For transmembrane proteins, analyzing conservation patterns specifically within membrane-spanning regions versus extracellular/intracellular domains can reveal whether lipid interaction surfaces or specific functional sites are under stronger selective pressure. When studying proteins with limited functional characterization like FLJ37396, comparison with better-understood proteins that show sequence or structural similarity can provide valuable functional hypotheses.

What is the current understanding of post-translational modifications affecting FLJ37396 function?

Post-translational modifications (PTMs) are crucial regulators of transmembrane protein function, though specific data for FLJ37396 may be limited:

  • Prediction and identification approaches:

    • Bioinformatic prediction of potential PTM sites (phosphorylation, glycosylation, etc.)

    • Mass spectrometry-based proteomics to identify actual modification sites

    • Comparison with known modification patterns in related proteins

  • Functional significance assessment:

    • Site-directed mutagenesis of predicted modification sites

    • Inhibitor studies to block specific modifications

    • Expression in systems with altered PTM capacity (like HEK293S GnTi- cells with simplified N-glycosylation)

  • Glycosylation analysis:

    • N-linked glycosylation often plays critical roles in transmembrane protein folding and function

    • Treatment with glycosidases can reveal glycosylation patterns

    • Expression in glycosylation-deficient systems can assess functional importance

  • Lipid modifications:

    • Predict potential palmitoylation or other lipid modification sites

    • Assess impacts on membrane localization and protein-protein interactions

For many transmembrane proteins, N-linked glycosylation is particularly critical for proper folding and trafficking. When expressing FLJ37396 for functional studies, researchers should consider whether native glycosylation patterns need to be maintained. The choice between expression systems like E. coli (which lacks glycosylation) versus mammalian systems should be guided by these considerations .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.