Recombinant Human Transmembrane protein LINC00477 (LINC00477)

Shipped with Ice Packs
In Stock

Description

LINC00477 Isoforms and Gastric Cancer

LINC00477 has multiple spliced isoforms, which may have less biological significance, but undergo alternative splicing specifically in noncoding exons . Isoform 1 of LINC00477 (L1) is downregulated in gastric cancer cells, while isoform 2 (L2) is upregulated . L1 functions as a tumor suppressor in gastric cancer cells, impacting cell growth and migration, whereas L2 has a less significant effect on gastric cancer development .

Interaction with ACO1

LINC00477 isoform 1 interacts with aconitase 1 (ACO1), an enzyme essential for the TCA cycle and intracellular iron control . L1 suppresses the conversion ability from citrate to isocitrate by ACO1 .

LINC00477 Expression in Gastric Cancer

LINC00477 is significantly downregulated in gastric cancer tissues compared to stomach tissues .

LINC00477 Transcript Levels in Gastric Cancer Studies

StudynGastric TissuesGC
Wang Q, et al48
Cui J, et al54
D’Errico M, et al38

*GC = Gastric Cancer

mRNA Levels of L1, L2, and Total LINC00477

The mRNA levels of L1, L2, and total LINC00477 were measured in gastric tissues, gastric mucosal epithelium, para-carcinoma tissue of adenocarcinoma and squamous carcinoma, adenocarcinoma, and squamous carcinoma .

Functional Studies in Gastric Cancer Cells

  • Cell Growth and Migration: Overexpression of L1 can repress cancer cell growth and migration, while silencing L2 has a less significant effect .

  • Tumor Suppression In Vivo: L1 has shown an inhibitory effect on the growth of AGS cells in vivo using xenograft mouse models .

Cell Growth of Gastric Cancer Cells with LINC00477 Modulation

Cell growth of MKN-45, AGS, and KATO III cells with L1 overexpression or L2 silencing, assessed by CCK-8 assay, shows that L1 overexpression represses cancer cell growth .

Migration Rate of Gastric Cancer Cells with LINC00477 Modulation

The migration rate of MKN-45, AGS, and KATO III cells with L1 overexpression or L2 silencing, assessed by wound healing assay, demonstrates that L1 overexpression reduces cell migration .

Tumor Volume in Xenograft Mouse Model

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
LINC00477; C12orf67; Putative transmembrane protein encoded by LINC00477
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-166
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
LINC00477
Target Protein Sequence
MLPFFSNTTSKSVSVSSFQGSPATPLSFLFFFFLCRAGSSMTGCFTFFLDFIFFFAGVLG PSPMGMYSGASTLTGFFLLRFLGQLSMDLEGLEWLGRASPSWWIFFSSSPSHRVPWGSCA SASAPRLPVPHPPSPLSKCPQHPRPRRTKGPGLRKLWGPGPPFFPS
Uniprot No.

Target Background

Database Links

HGNC: 26557

UniGene: Hs.350668

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is LINC00477 and what are its basic molecular characteristics?

LINC00477 (Long Intergenic Non-Protein Coding RNA 477) is a recently identified long non-coding RNA that does not encode a protein but plays regulatory roles in cellular processes. It has been implicated in various disease mechanisms, particularly in polycystic ovary syndrome (PCOS) . While primarily studied as a non-coding RNA, some research suggests it may produce a protein product in certain contexts .

Methodological approach: To characterize LINC00477, researchers typically employ RNA sequencing to determine its sequence and structure, followed by RT-qPCR for quantitative expression analysis using primers such as:

  • Forward primer: 5′-CGGGATCCAGTCTCTTCTTGCAAGGCCTTTCGC-3′

  • Reverse primer: 5′-GAATTCCGACCTTAGCCTATTTTCATAAGGC-3′

How is LINC00477 expression detected and measured in different biological samples?

Detection and measurement of LINC00477 can be accomplished through several complementary techniques:

  • qRT-PCR analysis - The gold standard for quantifying LINC00477 expression in serum, tissue samples, or cultured cells, with GAPDH commonly used as a normalizing control .

  • In situ hybridization (ISH) - Used to visualize LINC00477 expression patterns in tissue sections, particularly valuable for localization studies in tissues like ovarian samples .

  • RNA-Sequencing - For genome-wide expression profiling and discovery of novel LINC00477 variants.

For serum samples, immediate storage in liquid nitrogen post-collection is critical to preserve RNA integrity. For ISH staining of paraffin-embedded samples, probe hybridization is typically performed at 42°C overnight, followed by antibody detection and DAB coloration .

What is the role of LINC00477 in polycystic ovary syndrome (PCOS)?

LINC00477 has been identified as significantly upregulated in PCOS. Research has demonstrated approximately 3.3-fold higher expression in serum samples from PCOS patients compared to healthy controls (p < 0.001) . This elevated expression has also been confirmed in PCOS mouse models, with approximately 2.3-fold higher expression in ovarian tissue and 3.3-fold higher levels in serum compared to control mice .

Functionally, LINC00477 appears to regulate granulosa cell proliferation and apoptosis, which are critical processes in PCOS pathogenesis:

Effect of LINC00477Granulosa Cell ProliferationGranulosa Cell Apoptosis
OverexpressionInhibition (OD490: 0.80 vs. 1.41, p < 0.01)Promotion (Apoptosis rate: 27.13% vs. 10.07%, p < 0.01)
KnockdownPromotion (OD490: 1.04 vs. 0.50, p < 0.01)Inhibition (Apoptosis rate: 4.18% vs. 10.03%, p < 0.01)

These findings suggest LINC00477 may serve as both a biomarker and potential therapeutic target in PCOS .

How does LINC00477 interact with other molecular pathways in disease states?

LINC00477 functions through interaction with microRNAs, particularly miR-128. This interaction has been verified through multiple experimental approaches:

  • Bioinformatic prediction analysis identified miR-128 as a potential target of LINC00477 .

  • Dual-luciferase reporter assays confirmed direct binding between LINC00477 and miR-128 .

  • RNA pull-down assays demonstrated physical interaction between these molecules .

In other contexts, such as lung adenocarcinoma, LINC00477 (or similar lncRNAs like LINC00472) can interact with transcription factors such as Y-box binding protein 1 (YBX1) to regulate cell epithelial-mesenchymal transition (EMT) processes and mechanical properties, affecting invasion and metastasis .

How should researchers design experiments to manipulate LINC00477 expression in vitro?

When designing experiments to manipulate LINC00477 expression, researchers should consider:

  • Overexpression approach: Cloning LINC00477 cDNA into expression vectors (e.g., pmirGLO plasmid) for transfection into target cells using Lipofectamine 2000 or similar reagents .

  • Knockdown approach: Using small interfering RNAs (siRNAs) specifically targeting LINC00477. Multiple siRNA sequences should be tested for optimal knockdown efficiency. In previous studies, si-LINC00477 1# achieved better silencing effects than si-LINC00477 2# (fold change 0.26 vs. 0.34 compared to control) .

  • Verification of manipulation: RT-qPCR should be performed to confirm successful overexpression or knockdown before proceeding with functional assays. A 5-fold increase in overexpression experiments and at least 70% reduction in knockdown experiments is typically considered effective .

  • Appropriate controls: Empty vector for overexpression studies and non-targeting siRNA (si-NC) for knockdown experiments .

What are the key considerations for developing recombinant LINC00477 protein for research applications?

When producing recombinant LINC00477 protein:

  • Expression system selection: Cell-free protein synthesis (CFPS) systems have been successfully used for expressing recombinant LINC00477 .

  • Tagging strategy: Incorporating purification tags such as Strep-Tag can facilitate purification and detection. The AA 1-166 region has been successfully expressed with Strep-Tag conjugation .

  • Quality control measures: Verification of protein identity through mass spectrometry and functionality through binding assays is essential.

  • Storage conditions: Optimal buffer composition and storage temperature should be determined to maintain protein stability and activity.

  • Experimental validation: Functional testing to ensure the recombinant protein retains biological activity comparable to endogenous LINC00477.

How can researchers effectively analyze LINC00477-target interactions?

To analyze LINC00477-target interactions, several complementary approaches should be employed:

  • Bioinformatic prediction: Use computational tools to predict potential binding partners of LINC00477, such as microRNAs (e.g., miR-128) .

  • Dual-luciferase reporter assay: Clone LINC00477 cDNA fragments containing predicted microRNA binding sites into reporter plasmids (e.g., pmirGLO). Co-transfect with microRNA mimics or negative controls, then measure relative luciferase activity 48 hours post-transfection using a Dual-Luciferase Reporter Assay System .

  • RNA pull-down assay: Use biotinylated LINC00477 as bait to capture interacting molecules, followed by mass spectrometry or western blotting to identify bound proteins or RT-qPCR to identify bound RNAs .

  • RNA immunoprecipitation (RIP): Used to confirm protein-RNA interactions in a cellular context, as demonstrated for lncRNA-protein interactions like LINC00472-YBX1 .

  • Rescue experiments: Perform functional assays with both LINC00477 and its target (e.g., miR-128) manipulated to confirm the specificity and relevance of the interaction .

What statistical approaches are appropriate for analyzing LINC00477 expression data in clinical studies?

Statistical analysis of LINC00477 expression requires rigorous approaches:

  • Comparison between groups: Use Student's t-test for comparing two groups (e.g., PCOS vs. control) or one-way ANOVA for multiple groups. Data should be presented as mean ± SD .

  • Correlation analysis: To assess relationships between LINC00477 expression and clinical parameters, use Pearson or Spearman correlation coefficients depending on data distribution .

  • Survival analysis: Kaplan-Meier analysis with log-rank test can be used to evaluate the relationship between LINC00477 expression and patient outcomes, as demonstrated for other lncRNAs in cancer studies .

  • Multivariate analysis: Cox proportional hazards regression analysis can determine if LINC00477 is an independent prognostic factor .

  • ROC curve analysis: To evaluate the diagnostic or prognostic value of LINC00477 expression levels .

  • Statistical software: Analysis should be performed using validated statistical software such as SPSS (version 13.0 or later) .

Statistical significance is typically set at P < 0.05 .

How might LINC00477 be targeted for therapeutic applications?

Potential therapeutic strategies targeting LINC00477 include:

  • Antisense oligonucleotides (ASOs): Can be designed to specifically bind and inhibit LINC00477, reducing its expression levels.

  • siRNA-based approaches: Building on successful in vitro knockdown experiments, siRNA delivery systems could be developed to reduce LINC00477 levels in vivo .

  • Small molecule inhibitors: Could potentially disrupt specific interactions between LINC00477 and its targets, such as miR-128.

  • CRISPR-Cas9 gene editing: For long-term modulation of LINC00477 expression.

The selection of approach depends on the specific disease context. For PCOS, where LINC00477 is upregulated and contributes to granulosa cell dysfunction, knockdown strategies would be most appropriate .

What challenges exist in translating LINC00477 research from bench to bedside?

Several challenges must be addressed:

  • Delivery mechanisms: Developing efficient delivery systems to target LINC00477 modulators to specific tissues, particularly the ovaries for PCOS applications.

  • Off-target effects: Ensuring specificity of LINC00477 targeting to minimize unintended consequences.

  • Long-term efficacy and safety: Establishing appropriate duration of treatment and monitoring for late effects.

  • Biomarker validation: Confirming the utility of LINC00477 as a diagnostic or prognostic biomarker in larger, diverse patient populations.

  • Experimental design considerations: As with any therapeutic target, robust experimental design is crucial, including appropriate control groups, sufficient sample sizes, clear definitions of variables, and strategies to control confounding factors .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.