Recombinant Human Transmembrane protein LOC653160

Shipped with Ice Packs
In Stock

Description

General Functions of Transmembrane Proteins

Transmembrane proteins span cellular membranes, enabling interactions between extracellular and intracellular environments. Key roles include:

  • Signal transduction: G-protein-coupled receptors (GPCRs) and receptor tyrosine kinases (RTKs) mediate extracellular signal relay .

  • Transport: Ion channels (e.g., voltage-gated Na⁺ channels) and pumps (e.g., Na⁺/K⁺ ATPase) regulate solute movement .

  • Cell adhesion: Proteins like claudins and cadherins maintain tissue integrity .

Research Applications

Recombinant LOC653160 is likely used in:

Functional Studies

MethodPurpose
Binding assaysIdentify ligand partners (e.g., cytokines, hormones)
Co-IP/MSMap protein-protein interactions in signaling complexes
CRISPR knockoutsAssess phenotypic effects in cellular models

Therapeutic Targeting

  • VLPs/Nanodiscs: Claudin 18.2 and CXCR4 VLPs enable antibody screening for cancer therapies .

  • Drug discovery: Functional assays could identify small-molecule inhibitors or agonists.

Comparative Analysis with Related TMEM Proteins

The following table contrasts LOC653160 with characterized transmembrane proteins:

ProteinLocalizationFunctionCancer RoleSource
LOC653160UnknownHypothetical signaling/transportUndetermined
TMEM106BLate endosomes/lysosomesProtein turnover regulationLinked to FTLD pathology
Claudin 18.2Plasma membraneTight junction formationGastric cancer target
CXCR4Plasma membraneChemokine signalingCancer metastasis driver

Future Directions

  1. Structural elucidation: Cryo-EM or single-particle analysis to resolve transmembrane domains.

  2. Functional screening: High-throughput assays to identify interacting partners or ligands.

  3. Disease association: GWAS or proteomic studies to link LOC653160 to pathologies.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us; we will prioritize its use in production.
Synonyms
Transmembrane protein LOC653160
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-218
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Protein Sequence
MKGLRVAKAFQPSQGCSRQALGHLSGRGPSPRSEMNSSVGDLGVGGCSLWDDPARFIVVP AAYALALGLGLPANVAALAMFIRSGGRLGQALLLYLFNLALVDEFFTLTLQLWLTYYLGL ARRPPATRPGPPTTCPPMRRWSSPRSSACAAAASYAVPGPGRLPAWPGAYGAPRALPAPS PGWRAWPLPAWSTAGQARGWPPPRWPSRPPSCWCSRPT
Uniprot No.

Target Background

Database Links

UniGene: Hs.533986

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Human Transmembrane protein LOC653160?

Recombinant Human Transmembrane protein LOC653160 is a transmembrane protein that can be expressed in various expression systems including E. coli, yeast, baculovirus, or mammalian cells . The protein is typically produced as a partial recombinant form with purities exceeding 90% . While specific structural and functional details remain limited in the current literature, transmembrane proteins generally play crucial roles in cellular signaling, transport, and membrane organization.

What expression systems are suitable for producing Recombinant Human Transmembrane protein LOC653160?

Multiple expression systems can be employed for producing Recombinant Human Transmembrane protein LOC653160, including E. coli, yeast, baculovirus-infected insect cells, and mammalian cell lines . For eukaryotic integral membrane proteins like LOC653160, mammalian expression systems such as HEK293S GnTi- cells transduced with baculovirus (the BacMam system) are often advantageous as they provide the appropriate cellular machinery for proper folding and post-translational modifications . This approach addresses the complex technical challenges associated with generating recombinant membrane proteins for structural and biochemical analyses .

How should Recombinant Human Transmembrane protein LOC653160 be stored and handled?

For optimal stability, Recombinant Human Transmembrane protein LOC653160 should be stored at -20°C, with long-term storage recommended at either -20°C or -80°C . Working aliquots can be maintained at 4°C for up to one week . The protein is typically supplied in liquid form containing glycerol as a cryoprotectant . Repeated freeze-thaw cycles should be avoided as they can compromise protein integrity and function . When handling the protein, maintain sterile conditions and use appropriate protease inhibitors to prevent degradation.

What is the role of LOC653160 in cellular processes?

While specific functional roles of LOC653160 have not been extensively characterized in the provided literature, there is evidence suggesting its potential involvement in regulatory networks related to iron metabolism and possibly the Hippo-YAP signaling pathway . The protein has been included in studies investigating lncRNA-mediated cellular processes, particularly in the context of breast cancer research . Further research is needed to fully elucidate its functional significance and molecular interactions.

What is the recommended small-scale expression protocol for testing LOC653160 expression before scaling up?

For small-scale expression testing of transmembrane proteins like LOC653160, the following methodology is recommended:

  • Clone the LOC653160 gene into an appropriate expression vector (such as pEG BacMam) with a fluorescent fusion tag (e.g., mVenus) to facilitate expression monitoring .

  • Transfect HEK293T cells using PEI transfection:

    • Add 2 μg purified plasmid DNA to 100 μl unsupplemented DMEM

    • Add 6 μg PEI (1 mg/ml) to 100 μl unsupplemented DMEM

    • Combine the DNA and PEI mixtures and incubate at room temperature for 15-20 minutes

    • Add the mixture to HEK293T cells and incubate at 37°C for 48 hours

  • Harvest cells by centrifugation (3000 ×g, 10 min) after washing with PBS

  • Assess protein expression using fluorescence microscopy (if using a fluorescent tag) and analyze extraction efficiency with different detergents

This small-scale approach allows for evaluation of expression levels, proper folding, and identification of optimal solubilization conditions before scaling up production .

How can I optimize detergent selection for efficient extraction of LOC653160?

Detergent selection is critical for efficient extraction of transmembrane proteins like LOC653160. Implement a systematic screening approach:

  • Begin with mild, non-ionic detergents like n-Dodecyl-β-D-Maltopyranoside (DDM), as these often provide good extraction efficiency while maintaining protein stability .

  • If initial results are suboptimal, test a panel of detergents with varying properties:

    • Non-ionic detergents: Triton X-100, Digitonin

    • Zwitterionic detergents: CHAPS, CHAPSO

    • Combinations with cholesteryl hemisuccinate (CHS) and specific lipids like POPC

  • For each condition, evaluate:

    • Extraction efficiency (percentage of protein solubilized)

    • Protein monodispersity using size-exclusion chromatography

    • Retention of function using appropriate assays

Based on experience with other transmembrane proteins, some may extract well with DDM alone (like hDHHC15), while others may require specific detergent mixtures with CHS and/or lipids (like hPORCN, which benefits from DM+CHS+POPC) .

What purification strategy is most effective for Recombinant Human Transmembrane protein LOC653160?

Based on protocols established for similar transmembrane proteins, a multi-step purification strategy is recommended:

  • Solubilization: Resuspend cell pellet in buffer containing optimized detergent mixture and protease inhibitors (PMSF, AEBSF-HCl, Benzamidine HCl, Pepstatin, Leupeptin, Soy trypsin, and Aprotinin) .

  • Affinity Chromatography: If LOC653160 is expressed with an affinity tag (His, FLAG, etc.), use the corresponding affinity resin for initial capture.

  • Size Exclusion Chromatography: Further purify using SEC to isolate monodisperse protein and remove aggregates.

  • Quality Assessment: Evaluate purity by SDS-PAGE and monodispersity by fluorescence-detection size exclusion chromatography (FSEC) if using a fluorescent tag .

Throughout purification, maintain the optimal detergent concentration above its critical micelle concentration (CMC) to prevent protein aggregation, and include appropriate protease inhibitors to minimize degradation .

How can I assess the structural integrity and homogeneity of purified LOC653160?

Multiple complementary techniques should be employed to comprehensively evaluate the structural integrity and homogeneity of purified LOC653160:

These approaches collectively provide a comprehensive assessment of structural integrity that is essential before undertaking resource-intensive structural studies such as X-ray crystallography or cryo-EM.

What strategies can overcome expression challenges for LOC653160?

When encountering expression challenges with LOC653160, implement these advanced strategies:

  • Ortholog Screening: Test expression of LOC653160 orthologs from different species, as these may exhibit improved expression while maintaining functional relevance .

  • Construct Optimization:

    • Create truncations to remove disordered regions while preserving core domains

    • Test both N-terminal and C-terminal fusion tags to identify optimal positioning

    • Introduce thermostabilizing mutations based on computational predictions

  • Expression Condition Optimization:

    • Modulate expression temperature (30-37°C range)

    • Test chemical chaperones (DMSO, glycerol, specific lipids)

    • Evaluate expression at different time points post-induction

  • Advanced Expression Systems:

    • Utilize specialized HEK293S GnTi- cells that produce proteins with minimal N-glycosylation, enhancing homogeneity

    • Consider stable cell line development for consistent expression

  • Co-expression with Interacting Partners: If known, co-express LOC653160 with interaction partners that might stabilize its structure and enhance folding.

Each of these approaches addresses different aspects of the expression challenge, from protein instability to folding inefficiency, and may be combined for synergistic effects.

How does LOC653160 potentially interact with cellular signaling pathways?

While direct evidence for LOC653160's role in signaling pathways is limited, contextual analysis suggests possible involvement in:

  • Hippo-YAP Signaling: LOC653160 has been studied alongside investigations of lncRNAs that modulate the Hippo-YAP pathway, particularly LncRIM (ZBED5-AS1) . This pathway regulates organ size, tissue homeostasis, and has implications in cancer development.

  • Iron Metabolism Regulation: Research context suggests potential involvement in iron-dependent cellular processes . The protein may function within regulatory networks that control intracellular iron levels, which is critical for various cellular functions including proliferation.

  • Cancer-Related Processes: LOC653160 has been studied in the context of breast cancer research, suggesting potential roles in cancer cell metabolism or signaling .

To investigate these potential interactions, researchers should consider:

  • Co-immunoprecipitation assays to identify binding partners

  • Knockdown or overexpression studies to assess impact on pathway components

  • Phosphoproteomic analysis to detect changes in signaling cascades

  • Analysis of iron-dependent processes following LOC653160 modulation

How can RNA interference be effectively used to study LOC653160 function?

For effective RNA interference studies targeting LOC653160:

  • siRNA Design and Selection:

    • Utilize validated commercial siRNAs such as Lincode SMARTpool siRNAs that have been successfully used in previous studies

    • Design multiple siRNAs targeting different regions of the LOC653160 transcript to minimize off-target effects

    • Include appropriate non-targeting siRNA controls

  • Optimization of Transfection Conditions:

    • Determine optimal cell density, transfection reagent concentration, and siRNA concentration

    • Validate knockdown efficiency by RT-qPCR and western blot at multiple time points (24h, 48h, 72h)

  • Functional Readouts:

    • Assess changes in cellular phenotypes (proliferation, migration, apoptosis)

    • Analyze alterations in related pathways (e.g., Hippo-YAP signaling, iron metabolism markers)

    • Consider global approaches like RNA-seq to identify broader transcriptional changes

  • Rescue Experiments:

    • Introduce siRNA-resistant versions of LOC653160 to confirm specificity

    • Compare phenotypes between knockdown and rescue conditions

  • Combinatorial Approaches:

    • Combine LOC653160 knockdown with modulation of related pathway components

    • Test effects under different stress conditions (e.g., iron chelation or iron overload)

This methodical approach enables reliable functional characterization while minimizing misinterpretation due to off-target effects.

How can I address poor expression yields of LOC653160?

Poor expression yields can be systematically addressed through the following interventions:

  • Vector Optimization:

    • Evaluate different promoters (CMV, EF1α, CAG)

    • Test enhanced vectors like pEG BacMam, which is optimized for large-scale membrane protein expression

    • Incorporate enhancer elements like woodchuck hepatitis virus posttranscriptional regulatory element (WPRE)

  • Cell Culture Modification:

    • Add sodium butyrate (2-10 mM) to enhance expression in mammalian cells

    • Optimize cell density at transfection/infection

    • Extend expression time while monitoring cell viability

  • Host Cell Selection:

    • Compare expression between different cell lines (HEK293T, HEK293S GnTi-, CHO, Sf9)

    • Consider stable cell line development for consistent expression

  • BacMam Virus Optimization (if using BacMam system):

    • Increase virus titers or multiplicity of infection (MOI)

    • Add enhancers like fluorescent fusion tags (mVenus) that often yield higher expression than other tags

  • Protein Engineering Approaches:

    • Create fusion constructs with well-expressed soluble proteins

    • Remove predicted problematic regions while preserving functional domains

Each intervention should be systematically tested and quantified for impact on both yield and protein quality.

What should be considered when scaling up LOC653160 production from small-scale to large-scale?

Scaling up production requires careful consideration of multiple factors:

  • Process Parameters Translation:

    • Determine scalable parameters from small-scale optimization

    • Establish critical quality attributes (purity, activity, homogeneity)

    • Validate that large-scale expression maintains protein quality

  • Bioreactor Considerations (for suspension cultures):

    • Optimize oxygen transfer rates

    • Establish appropriate mixing parameters to avoid shear stress

    • Develop feeding strategies for extended expression periods

  • Infection/Transfection Strategy:

    • For BacMam system, ensure consistent virus quality across batches

    • Develop direct large-scale virus production methods that circumvent multiple generations of virus production

    • Consider the baculovirus to cell ratio for optimal expression

  • Harvest and Downstream Processing:

    • Develop scalable cell harvesting methods

    • Ensure efficient extraction with optimized detergent systems

    • Implement scalable purification strategies maintaining critical parameters

  • Quality Control:

    • Establish in-process controls to monitor expression

    • Use FSEC as a simple method for assessing protein quality without determining titers

    • Develop batch release criteria based on purity, homogeneity, and function

Systematic development of these parameters ensures consistent protein quality during scale-up operations.

How can I differentiate between properly folded and misfolded LOC653160?

Distinguishing properly folded from misfolded protein is critical for reliable experimental outcomes:

Implementing multiple orthogonal techniques provides more reliable assessment than any single method alone.

What are promising approaches for structural studies of LOC653160?

Several complementary approaches show promise for elucidating LOC653160 structure:

  • Cryo-Electron Microscopy:

    • Particularly suitable for membrane proteins that may be challenging to crystallize

    • Can reveal structural details with near-atomic resolution

    • Compatible with detergent-solubilized, amphipol-stabilized, or nanodisc-reconstituted protein

  • X-ray Crystallography Optimization:

    • Implement lipidic cubic phase (LCP) crystallization specifically designed for membrane proteins

    • Screen fusion partners (e.g., T4 lysozyme, BRIL) to enhance crystallization propensity

    • Utilize surface entropy reduction mutations to promote crystal contacts

  • Integrative Structural Biology:

    • Combine lower-resolution techniques (SAXS, negative stain EM) with computational modeling

    • Implement cross-linking mass spectrometry (XL-MS) to obtain distance constraints

    • Use hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map dynamic regions

  • NMR Approaches:

    • Solution NMR for smaller domains or fragments

    • Solid-state NMR for full-length protein in native-like membrane environments

  • Emerging Technologies:

    • Microcrystal electron diffraction (MicroED) for small crystals unsuitable for traditional X-ray diffraction

    • Serial femtosecond crystallography at X-ray free-electron lasers (XFELs)

The appropriate method selection should be guided by protein size, stability, and available quantity, with multiple approaches often needed for comprehensive structural characterization.

How might LOC653160 function in the context of disease models?

Understanding LOC653160's potential roles in disease contexts requires multi-faceted investigation:

  • Cancer Biology:

    • Analyze expression patterns across cancer types and correlate with patient outcomes

    • Investigate potential involvement in the Hippo-YAP pathway, which is frequently dysregulated in cancer

    • Examine relationships with iron metabolism in the context of cancer progression, as iron homeostasis is critical for rapidly proliferating cells

  • Iron-Related Disorders:

    • Explore potential roles in conditions characterized by iron dysregulation

    • Investigate interactions with established iron metabolism proteins (DMT1, TFR1) that have been linked to lncRNA-mediated regulation in the LOC653160 research context

  • Signaling Pathway Dysregulation:

    • Examine potential contributions to aberrant signaling through the Hippo pathway

    • Investigate possible interactions with tumor suppressor NF2, which was identified as binding to lncRNAs in related research

  • Functional Models:

    • Develop knockout/knockdown models in relevant cell lines

    • Create animal models with tissue-specific modulation

    • Utilize patient-derived samples to correlate expression with disease parameters

This multidimensional approach can reveal mechanistic insights into LOC653160's potential roles in disease pathogenesis, potentially identifying novel therapeutic targets or biomarkers.

What computational approaches can predict LOC653160 structure and function?

Advanced computational methods offer valuable insights into LOC653160 structure and function:

  • Deep Learning Structure Prediction:

    • Implement AlphaFold2 or RoseTTAFold to generate high-confidence structural models

    • Use specialized membrane protein-specific prediction algorithms that account for lipid bilayer constraints

    • Generate multiple models and assess confidence through ensemble analysis

  • Molecular Dynamics Simulations:

    • Simulate protein behavior in membrane environments using GROMACS or NAMD

    • Investigate conformational dynamics and potential functional states

    • Test stability of predicted structures in various membrane compositions

  • Protein-Protein Interaction Prediction:

    • Apply sequence-based methods (PIPE, STRING) to predict potential interactors

    • Use structure-based docking to evaluate specific interactions with candidates like NF2

    • Implement topological data analysis to identify network relationships

  • Functional Site Prediction:

    • Identify conserved functional domains through comparative genomics

    • Predict binding sites using algorithms like FTSite or COACH

    • Map potential post-translational modification sites using tools like NetPhos or UbPred

  • Evolutionary Analysis:

    • Conduct comprehensive phylogenetic analysis to identify conserved regions

    • Implement evolutionary coupling analysis to predict residue contacts

    • Use conservation patterns to infer functionally important regions

These computational approaches generate testable hypotheses that can guide experimental design and provide context for interpreting experimental findings.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.