Recombinant Human Transmembrane protein with metallophosphoesterase domain (TMPPE)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Transmembrane Protein with Metallophosphoesterase Domain (TMPPE)

The Recombinant Human Transmembrane Protein with Metallophosphoesterase Domain, abbreviated as TMPPE, is a protein of interest in biomedical research due to its unique structure and potential enzymatic activities. TMPPE belongs to a group of transmembrane proteins, which are integral components of cell membranes and play crucial roles in various cellular processes, including signaling, transport, and protein trafficking . This article aims to provide a comprehensive overview of TMPPE, including its structure, function, and current research findings.

Structure and Function of TMPPE

TMPPE is characterized by its metallophosphoesterase domain, which suggests enzymatic activity related to the hydrolysis of phosphoester bonds. This domain is significant in various biochemical pathways, potentially involving the regulation of signaling molecules or the degradation of phosphoester-containing compounds . TMPPE is a transmembrane protein, meaning it spans the cell membrane, which could facilitate interactions with both intracellular and extracellular components .

CharacteristicsDescription
DomainMetallophosphoesterase domain
LocationTransmembrane
FunctionPotential enzymatic activity related to phosphoester hydrolysis

Research Findings and Implications

Research AreaFindings
Transmembrane ProteinsTMPPE is part of the 5TM group, which is involved in localization and transport activities.
Enzymatic ActivityPotential role in phosphoester hydrolysis, though specific substrates and pathways are not well-defined.
Disease AssociationNot explicitly linked to specific diseases, but transmembrane proteins are often implicated in disease pathways.

Recombinant Expression and Applications

Recombinant expression of TMPPE involves the production of this protein in a controlled environment, such as bacterial or mammalian cell cultures, to facilitate its study and potential applications. Recombinant TMPPE can be used in biochemical assays to investigate its enzymatic activity, interactions with other proteins, or its role in cellular processes .

ApplicationDescription
Biochemical AssaysTo study enzymatic activity and substrate specificity.
Protein-Protein InteractionsTo identify interacting partners and understand its role in cellular networks.
Therapeutic PotentialPotential use in drug development targeting related pathways.

Future Directions

Given the limited current understanding of TMPPE's function and its potential implications in cellular processes, further research is necessary to fully elucidate its role. This includes detailed biochemical characterization, investigation of its involvement in disease pathways, and exploration of its therapeutic potential.

Future Research DirectionsObjectives
Biochemical CharacterizationDefine enzymatic activity and substrate specificity.
Disease Association StudiesInvestigate potential links to human diseases.
Therapeutic ApplicationsExplore potential uses in drug development.

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently available in our inventory. However, if you have specific requirements for the format, please indicate them in your order remarks. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery estimates.
All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of our products is influenced by several factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be decided during production. If you have a preference for a particular tag type, please inform us, and we will prioritize its development whenever feasible.
Synonyms
TMPPE; Transmembrane protein with metallophosphoesterase domain
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-453
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMPPE
Target Protein Sequence
MAIFRQLSLGAKATLAAVTVFVSMIASRSYLAESLELRAWRWLLRLQLALFVNSLLLIGS LYIWRSTVSNLCHSPAAESTCFQLWKVVVLAFLALAHSSFFTMFFLVAEEPYLFSLAAYS CLGAYIIMLFFLFILSGMEQAYQLLAWRSGRVVGSLEKTRKLVLRPALAVGVTAVLSVAG ILNAAQPPAVKTVEVPIHQLPASMNNLKIVLLSDIHLGPTVGRTKMEMFVRMVNVLEPDI TVIVGDLSDSEASVLRTAVAPLGQLHSHLGAYFVTGNHEYYTSDVSNWFALLESLHVQPL HNENVKISATRAQRGGGGSGSGSEDEDWICLAGVDDIEADILHYSGHGMDLDKALEGCSP DHTIILLAHQPLAAKRALQARPDINLILSGHTHAGQIFPLNVAAYLLNPFFAGLYQVAQA TFVYVSPGTAYYGIPMRLGSRAEITELILQRSP
Uniprot No.

Target Background

Database Links

HGNC: 33865

KEGG: hsa:643853

UniGene: Hs.443031

Protein Families
Metallophosphoesterase superfamily, LOC643853 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the predicted membrane topology of human TMPPE?

Human TMPPE belongs to the family of transmembrane proteins with a metallophosphoesterase domain. Based on computational predictions and experimental evidence, TMPPE likely possesses a five-transmembrane (5TM) architecture. Approximately half of the proteins with 5TM architecture have their N-terminal in the cytoplasmic environment and C-terminal in the luminal region, while the other half display the opposite orientation . Specifically, metallophosphoesterases like MPPE1 are integral membrane proteins required for the transport of GPI-anchored proteins from the endoplasmic reticulum to the Golgi apparatus .

For accurate topology determination of recombinant TMPPE, researchers should employ multiple complementary approaches:

  • Computational prediction using TOPCONS2

  • Protease protection assays with epitope-tagged constructs

  • Glycosylation site mapping

  • Cysteine accessibility methods

What cellular localization patterns does TMPPE exhibit?

TMPPE predominantly localizes to the Golgi apparatus, consistent with its role in GPI-anchor protein processing and transport . Secondary localization to the nucleoplasm has also been reported, though its functional significance remains under investigation. Immunofluorescence microscopy reveals co-localization with Golgi markers such as GM130, while subcellular fractionation studies confirm enrichment in Golgi-derived membrane fractions.

Cellular CompartmentLocalization EvidenceMethods for Detection
Golgi apparatusPrimary localization siteImmunofluorescence, subcellular fractionation
NucleoplasmSecondary localizationImmunofluorescence, nuclear extraction
ER-Golgi transport vesiclesTransient localizationLive-cell imaging, vesicle isolation

How does TMPPE compare to other metallophosphoesterases in the human proteome?

TMPPE shares functional similarities with MPPE1 (Metallophosphoesterase 1), particularly in its enzymatic domain. MPPE1 functions in lipid remodeling steps of GPI-anchor maturation by removing a side-chain ethanolamine-phosphate (EtNP) from the second mannose (Man2) of GPI intermediates . This processing is essential for efficient transport of GPI-anchored proteins. The metallophosphoesterase domain likely confers TMPPE with similar hydrolase activity and phosphoric diester hydrolase activity, though with potentially distinct substrate specificity.

What expression systems yield optimal results for recombinant TMPPE production?

For functional studies of recombinant TMPPE, mammalian expression systems generally provide superior results compared to bacterial or insect cell systems. This preference stems from the requirement for proper post-translational modifications and membrane integration.

Expression SystemAdvantagesLimitationsRecommended for
HEK293 cellsProper folding, mammalian PTMs, moderate yieldHigher cost, longer production timeFunctional studies, interaction analyses
CHO cellsHigh yield, stable expressionClone selection timeLarge-scale production, crystallography
Sf9 insect cellsGood compromise between yield and PTMsSome mammalian PTMs missingInitial screening, protein-protein interaction studies
E. coliVery high yield, cost-effectivePoor folding of TM regions, no PTMsDomain studies (metallophosphoesterase domain only)

When expressing full-length TMPPE in mammalian systems, consider using a C-terminal tag such as FLAG or His6 to avoid disrupting N-terminal signal sequences. For membrane extraction, a combination of detergents including DDM (n-Dodecyl β-D-maltoside) at 1% concentration has shown efficacy in solubilizing the protein while preserving enzymatic activity.

What are the optimal conditions for assessing TMPPE enzymatic activity in vitro?

TMPPE's metallophosphoesterase activity can be assayed using artificial substrates such as p-nitrophenyl phosphate or physiologically relevant substrates like GPI-anchor precursors. Based on studies with related metallophosphoesterases, the following conditions typically yield optimal activity:

  • Buffer: 50 mM HEPES, pH 7.2-7.5

  • Essential cofactors: 1-2 mM Mn²⁺ (primary), Mg²⁺ (secondary)

  • Temperature: 37°C

  • Detergent: 0.1% DDM (critical for maintaining protein stability)

Activity can be monitored through:

  • Colorimetric assays for phosphate release

  • HPLC analysis of substrate conversion

  • Mass spectrometry of modified GPI anchors

A key consideration is the potential inhibition by metal chelators such as EDTA and EGTA, which should be excluded from all buffers during purification and assay procedures.

What strategies overcome challenges in generating TMPPE knockout cell lines?

Creating TMPPE knockout cell lines presents challenges due to potential essential functions in certain cell types. Successful strategies include:

  • CRISPR-Cas9 with multiple guide RNAs targeting early exons

    • Recommended guide RNA design: target exons encoding the metallophosphoesterase domain

    • Include PAM sites with highest specificity scores

    • Verify knockouts through genomic sequencing, Western blotting, and RT-qPCR

  • Inducible knockout systems for essential genes

    • Tet-on/off regulation of Cas9 or guide RNA expression

    • Conditional approaches using Cre-loxP systems

  • Domain-specific mutagenesis targeting catalytic residues

    • Site-directed mutagenesis of conserved metal-binding residues

    • Creation of catalytically inactive mutants preserving structural integrity

When phenotyping TMPPE knockout lines, examine GPI-anchored protein transport efficiency using pulse-chase experiments and assess Golgi morphology through transmission electron microscopy and immunofluorescence.

What protein-protein interaction networks involve TMPPE?

Understanding TMPPE's interactome is crucial for elucidating its cellular functions. Based on studies of related metallophosphoesterases and 5TM proteins, several approaches can reveal TMPPE interaction partners:

  • Proximity labeling methods

    • BioID or TurboID fusion to TMPPE N- or C-terminus

    • APEX2-based proximity labeling

    • Analysis by mass spectrometry followed by validation

  • Co-immunoprecipitation coupled with mass spectrometry

    • Use mild detergents to preserve membrane protein interactions

    • Consider crosslinking approaches to capture transient interactions

  • Membrane yeast two-hybrid (MYTH) system

    • Particularly useful for identifying interactions between membrane proteins

    • Split-ubiquitin approach circumvents limitations of classical Y2H

Predicted interaction partners likely include:

  • Components of COPII-coated vesicles (similar to other 5TM proteins involved in ER-to-Golgi transport)

  • GPI-anchor biosynthetic enzymes

  • Golgi-resident proteins involved in protein trafficking

How do post-translational modifications regulate TMPPE activity?

Post-translational modifications (PTMs) likely play crucial roles in regulating TMPPE function. Based on studies of related proteins, several key modification sites and their functional impacts can be predicted:

Modification TypePredicted SitesFunctional ImpactDetection Method
N-terminal acetylationFirst or second residueProtein stability, localizationMass spectrometry
PhosphorylationCytoplasmic loopsActivity regulation, protein interactionsPhospho-specific antibodies, MS
GlycosylationExtracellular/luminal domainsProtein folding, stabilityGlycosidase treatment, lectin blotting
PalmitoylationCysteine residues near TM domainsMembrane association, traffickingClick chemistry, metabolic labeling

To study these modifications:

  • Employ site-directed mutagenesis to create non-modifiable variants

  • Use mass spectrometry approaches optimized for membrane proteins

  • Apply specific inhibitors of PTM-regulating enzymes to assess functional consequences

What structural approaches can reveal TMPPE's catalytic mechanism?

Understanding TMPPE's three-dimensional structure is crucial for elucidating its catalytic mechanism and developing potential modulators. Several complementary approaches can be employed:

  • Cryo-electron microscopy

    • Most promising for full-length membrane protein structure

    • Requires optimization of detergent or nanodisc reconstitution

    • Consider lipid nanodiscs to maintain native-like environment

  • X-ray crystallography of the metallophosphoesterase domain

    • Express soluble domain independently

    • Optimize protein stability through limited proteolysis

    • Screen multiple constructs with varying domain boundaries

  • Computational modeling and molecular dynamics simulations

    • Homology modeling based on related metallophosphoesterases

    • Molecular dynamics to predict substrate binding and catalysis

    • Virtual screening for potential inhibitors or activators

For functional validation of structural insights:

  • Site-directed mutagenesis of predicted catalytic residues

  • Hydrogen-deuterium exchange mass spectrometry

  • Cross-linking mass spectrometry for domain arrangement

How might TMPPE function in specialized cellular compartments beyond the Golgi?

While TMPPE's primary localization is in the Golgi apparatus, emerging evidence suggests potential roles in additional cellular compartments. The reported nucleoplasmic localization of TMPPE raises intriguing questions about non-canonical functions:

  • Potential nuclear roles:

    • Regulation of nuclear envelope proteins

    • Processing of nuclear-localized GPI-anchored proteins

    • Involvement in nuclear phospholipid metabolism

  • Investigation approaches:

    • Selective permeabilization techniques to distinguish membrane-bound vs. soluble pools

    • Subcellular fractionation with high-resolution separation of organelles

    • Proximity labeling with compartment-specific markers

  • Specialized imaging techniques:

    • Super-resolution microscopy (STORM, PALM)

    • Correlative light and electron microscopy (CLEM)

    • Live-cell imaging with photoactivatable fluorescent protein fusions

What role might TMPPE play in cellular stress responses?

Transmembrane proteins often participate in cellular stress responses through specialized mechanisms. For TMPPE, potential stress-related functions may include:

  • ER stress and the unfolded protein response

    • Potential role in alleviating protein folding stress through GPI-anchor processing

    • Expression changes during UPR activation

    • Interaction with stress-responsive proteins

  • Oxidative stress

    • Metal-binding properties of the metallophosphoesterase domain may confer sensitivity to redox state

    • Potential regulation through oxidation of conserved cysteine residues

  • Experimental approaches:

    • Transcriptome and proteome analysis following stress induction

    • Survival assays in TMPPE-modified cells under stress conditions

    • Analysis of post-translational modifications induced by stress

Recent studies of 5TM proteins reveal distinct stress adaptation patterns compared to canonical stress response proteins like Clp proteases and chaperones (GroES-GroEL and DnaJ-DnaK-GrpE) , suggesting specialized roles for transmembrane proteins like TMPPE in stress response.

How does TMPPE contribute to intercellular communication?

Given the importance of GPI-anchored proteins in cell signaling and intercellular communication, TMPPE may indirectly influence these processes:

  • Potential roles in extracellular vesicle (EV) composition

    • Regulation of GPI-anchored protein sorting into EVs

    • Altered EV cargo and recipient cell responses in TMPPE-deficient cells

  • Investigation approaches:

    • Proteomics analysis of EVs from TMPPE-modified cells

    • Tracking of fluorescently labeled GPI-anchored proteins

    • Functional assays of recipient cell responses to EVs

  • Relevance to tissue-specific functions

    • Brain, liver, and testis show prominent expression of many 5TM proteins

    • Potential involvement in specialized intercellular communication in these tissues

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.