Recombinant Human Tripartite motif-containing protein 59 (TRIM59)

Shipped with Ice Packs
In Stock

Description

Introduction

Tripartite motif-containing protein 59 (TRIM59) is a member of the TRIM protein family, which includes more than 70 evolutionarily conserved proteins sharing Really Interesting New Gene (RING), B-Box, and coiled-coil (RBCC) domains . Possessing a highly conserved RING domain, TRIM59 functions as an E3 ubiquitin ligase, influencing post-translational modifications and various cellular processes such as cell growth, apoptosis, and immunity . Studies have identified TRIM59 as a significant factor in cancer prognosis and development .

Structure and Function

TRIM proteins, including TRIM59, typically consist of an N-terminal RING finger domain, one or two B-box motifs, and a coiled-coil region . As an E3 ubiquitin ligase, TRIM59 facilitates the transfer of ubiquitin to target proteins,modifying them and thereby affecting numerous cellular functions .

Expression and Prognostic Value in Cancers

TRIM59 expression levels have been examined in various cancers, including non-small cell lung cancer (NSCLC) and epithelial ovarian cancer (EOC) . Studies using immunohistochemistry have localized TRIM59 primarily in the cytoplasm of tumor cells . Analysis of The Cancer Genome Atlas (TCGA) database has identified TRIM59 as a potential target in lung cancer .

Table 1: Diagnostic Efficacy of TRIM59 in Various Cancers

Cancer TypePrediction Accuracy
CHOLUp to 100%

TRIM59 demonstrates high diagnostic efficacy in multiple cancers, particularly CHOL (cholangiocarcinoma), with prediction accuracy reaching 100% . Meta-analysis of GEO datasets revealed that high TRIM59 expression correlates with poor prognosis in KIRP (kidney renal papillary cell carcinoma), LGG (lower-grade glioma), and LUAD (lung adenocarcinoma), and lung cancer .

Role in Epithelial Ovarian Cancer (EOC)

In epithelial ovarian cancer, TRIM59 is highly expressed and correlated with patient prognosis . Studies indicate that silencing TRIM59 can suppress EOC cell proliferation, migration, and invasion. Mechanistically, TRIM59 influences the FAK/AKT/MMP pathway, suggesting its role in EOC progression .

TRIM59 as a Diagnostic Marker

High expression of TRIM59 shows potential as a diagnostic marker in various types of human cancers . ROC (Receiver Operating Characteristic) analysis indicates that TRIM59 exhibits high diagnostic efficacy in several tumors.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for your preparation.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
TRIM59; RNF104; TRIM57; TSBF1; Tripartite motif-containing protein 59; RING finger protein 104; Tumor suppressor TSBF-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-403
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MHNFEEELTCPICYSIFEDPRVLPCSHTFCRNCLENILQASGNFYIWRPLRIPLKCPNCR SITEIAPTGIESLPVNFALRAIIEKYQQEDHPDIVTCPEHYRQPLNVYCLLDKKLVCGHC LTIGQHHGHPIDDLQSAYLKEKDTPQKLLEQLTDTHWTDLTHLIEKLKEQKSHSEKMIQG DKEAVLQYFKELNDTLEQKKKSFLTALCDVGNLINQEYTPQIERMKEIREQQLELMALTI SLQEESPLKFLEKVDDVRQHVQILKQRPLPEVQPVEIYPRVSKILKEEWSRTEIGQIKNV LIPKMKISPKRMSCSWPGKDEKEVEFLKILNIVVVTLISVILMSILFFNQHIITFLSEIT LIWFSEASLSVYQSLSNSLHKVKNILCHIFYLLKEFVWKIVSH
Uniprot No.

Target Background

Function
Recombinant Human Tripartite motif-containing protein 59 (TRIM59) may function as a multifunctional regulator in innate immune signaling pathways.
Gene References Into Functions
  • TRIM59 overexpression is observed in hepatocellular carcinoma (HCC) cells, promoting cell proliferation, migration, and invasion (PMID: 29442042).
  • TRIM59 levels correlate with malignant features of colorectal carcinoma (CRC), suggesting potential therapeutic and preventive applications (PMID: 28849218).
  • TRIM59 knockdown shows promise as a strategy for early detection and treatment of renal cell carcinoma (PMID: 28719348).
  • TRIM59 overexpression is linked to colorectal cancer metastasis (PMID: 28534983).
  • The rs1141023 polymorphism in TRIM59 may increase susceptibility to gastric cancer (PMID: 28009992).
  • Elevated TRIM59 expression is noted in cervical cancers (PMID: 27662486).
  • TRIM59 demonstrates oncogenic properties in osteosarcoma, stimulating cell proliferation, migration, and invasion (PMID: 27121462).
  • TRIM59 knockdown studies suggest that its promotion of non-small cell lung cancer (NSCLC) cell growth may occur via pathways other than the p53 signaling pathway (PMID: 26599082).
  • TRIM59 interacts with p53, promoting its ubiquitination and degradation; this mechanism may contribute to gastric carcinogenesis (PMID: 25046164).
  • Research indicates that TRIM59 serves as a multifunctional regulator of innate immune signaling pathways (PMID: 22588174).
  • PMID: 12095697 refers to the mouse Mrf1 gene, a homolog of human TSBF1.
Database Links

HGNC: 30834

OMIM: 616148

KEGG: hsa:286827

STRING: 9606.ENSP00000311219

UniGene: Hs.212957

Protein Families
TRIM/RBCC family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

Advanced Research Questions

  • What molecular mechanisms underlie TRIM59's protective effects in atherosclerosis progression?

    TRIM59 exerts protective effects in atherosclerosis through multiple interconnected mechanisms. At the molecular level, TRIM59 physically binds to Annexin A2 (AnxA2) as confirmed by co-immunoprecipitation studies, promoting AnxA2 expression in endothelial cells . This interaction appears critical for TRIM59's anti-inflammatory and cell-protective functions. In ox-LDL-induced endothelial cells, TRIM59 overexpression counteracts cell damage by preserving viability and reducing inflammatory marker expression, including adhesion molecules ICAM-1 and VCAM-1 . The protective mechanism also involves modulation of apoptotic pathways, with TRIM59 overexpression increasing anti-apoptotic Bcl-2 while reducing pro-apoptotic BAX and cleaved caspase3 expression . For experimental investigation of these pathways, researchers should employ combined approaches of protein interaction studies, pathway-specific inhibitors, and targeted gene silencing to delineate the relative contributions of these mechanisms.

  • How does the interaction between TRIM59 and AnxA2 influence endothelial cell function in atherosclerosis models?

    The TRIM59-AnxA2 interaction represents a novel regulatory axis in endothelial homeostasis during atherogenesis. Research demonstrates that TRIM59 physically binds to AnxA2 and promotes its expression in endothelial cells . Under ox-LDL-induced stress conditions, both TRIM59 and AnxA2 expression levels decline significantly, but TRIM59 overexpression can rescue AnxA2 levels . Mechanistically, this interaction appears to be essential for TRIM59's protective effects, as silencing AnxA2 abolishes the benefits of TRIM59 overexpression on cell viability, inflammatory responses, and apoptotic regulation . This suggests the TRIM59-AnxA2 axis functions as a critical checkpoint in endothelial inflammatory and cell death pathways. For experimental evaluation of this interaction, researchers should consider employing proximity ligation assays, FRET-based interaction studies, and domain-specific mutation approaches to identify the precise binding interfaces.

  • What are the implications of TRIM59 expression in cancer immunology and tumor microenvironment?

    TRIM59 demonstrates significant correlations with tumor immune microenvironment parameters. Bioinformatic analyses reveal that TRIM59 expression significantly correlates with the ESTIMATE score (P=0.04) and stromal score (P=0.005) in lung adenocarcinoma (LUAD), suggesting a relationship with tumor microenvironment composition . Most notably, TRIM59 shows a significant correlation with tumor mutation burden specifically in LUAD (P<0.001), potentially influencing neoantigen presentation and immune recognition . At the cellular level, TRIM59 expression correlates with specific immune cell infiltration markers, particularly those associated with neutrophils and dendritic cells . These correlations suggest TRIM59 may influence tumor immunogenicity and immune cell recruitment/function. Experimental approaches to investigate these relationships should incorporate immune cell co-culture systems, cytokine profiling, and in vivo immune-competent models with TRIM59 manipulation.

  • What are the optimal experimental models for studying TRIM59 function in cardiovascular disease?

    For comprehensive investigation of TRIM59 in cardiovascular disease, researchers should employ a multi-level experimental approach. In vitro models should include primary human endothelial cells (HUVECs or HAECs) treated with physiologically relevant concentrations of ox-LDL (20-100 μg/mL) to simulate atherogenic conditions . Genetic manipulation through overexpression vectors (Ov-TRIM59) or siRNA/shRNA approaches provides mechanistic insights . For higher complexity, co-culture systems incorporating endothelial cells with monocytes/macrophages better recapitulate inflammatory cell recruitment and adhesion processes . In vivo models should include ApoE-/- or LDLR-/- mice with tissue-specific TRIM59 manipulation (endothelial-specific knockout or overexpression) followed by comprehensive assessment of plaque development, composition, and inflammatory profiles. Single-cell transcriptomics from atherosclerotic lesions can provide high-resolution data on TRIM59 expression patterns across cell types within the vascular wall.

  • How can researchers effectively analyze TRIM59 protein interactions and post-translational modifications?

    Investigation of TRIM59 interactome and modifications requires sophisticated methodological approaches. For protein interactions, co-immunoprecipitation has successfully demonstrated the TRIM59-AnxA2 binding , but should be complemented with proximity-based methodologies such as BioID or APEX2 to capture transient interactions. Mass spectrometry-based approaches including IP-MS or crosslinking mass spectrometry (XL-MS) can identify novel binding partners and interaction interfaces. For post-translational modifications, a combination of phosphoproteomic, ubiquitinomic, and SUMOylation analyses should be performed on purified recombinant TRIM59 and endogenous protein from relevant cell types. Given TRIM59's RING domain and potential E3 ligase activity, particular attention should be paid to ubiquitination patterns using ubiquitin remnant profiling and in vitro ubiquitination assays with candidate substrates.

  • What signaling pathways intersect with TRIM59 function in inflammatory conditions?

    TRIM59 appears to interface with multiple signaling pathways relevant to inflammatory processes. In endothelial cells, TRIM59 modulates pathways associated with cell survival, inflammation, and adhesion molecule expression . While specific signaling mechanisms haven't been fully characterized, the protective effects of TRIM59 in ox-LDL-treated endothelial cells suggest potential intersection with NF-κB signaling (given effects on inflammatory cytokines), apoptotic pathways (via Bcl-2/BAX/caspase regulation), and adhesion molecule regulation (ICAM-1/VCAM-1) . The interaction with AnxA2 provides another potential signaling node, as AnxA2 participates in various cellular processes including membrane organization and signal transduction . For pathway analysis, researchers should employ phospho-specific antibody arrays, pathway-specific reporter assays, and targeted inhibition of candidate pathways to establish the signaling networks through which TRIM59 exerts its effects in different cellular contexts.

  • How does TRIM59 expression heterogeneity impact experimental reproducibility and clinical correlation?

    TRIM59 expression demonstrates significant context-dependent variations that impact experimental approaches and clinical interpretations. In atherosclerosis models, TRIM59 is downregulated during disease progression , while in certain cancers like LUAD, TRIM59 overexpression correlates with poor outcomes . This bidirectional expression pattern necessitates careful experimental design with appropriate controls and validation across multiple model systems. For clinical correlations, researchers should stratify analyses based on disease stage, tissue microenvironment characteristics, and concomitant molecular features. Experimental approaches should include dose-response studies with TRIM59 expression at different levels rather than simple overexpression/knockdown binary models. Single-cell approaches will be particularly valuable for resolving cell-specific expression patterns within heterogeneous tissues, while longitudinal sampling in disease models can capture dynamic expression changes during disease progression or therapeutic response.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.