Recombinant Human Tumor necrosis factor ligand superfamily member 12 (TNFSF12)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Isoforms

Recombinant TNFSF12 typically consists of the TNF homology domain (THD) spanning residues 93-249 of the full-length protein. Key structural features include:

PropertySpecificationSource
Molecular Weight17.2-18.7 kDa
Amino Acid Range93-249 (Human)
Common TagsHis-tag (6-8 residues), FLAG-tag
Disulfide BondsConserved cysteine residues
Quaternary StructureHomotrimeric configuration

The protein exists in both membrane-bound and soluble forms, with proteolytic processing generating the bioactive extracellular domain .

Production Systems and Purification

Commercial production employs multiple expression platforms:

Expression HostYieldPurityEndotoxinsKey Features
E. coli25-100 µg>95%<1.0 EU/µgCost-effective, non-glycosylated
HEK293Variable>90%≤0.005 EU/µgProper folding, post-translational modifications
CHO CellsHigh>98%UndetectableScalable for therapeutic use

Lyophilization remains the preferred stabilization method, with reconstitution requiring PBS buffers containing carrier proteins (0.1-0.5% BSA/HSA) .

Receptor Interactions

Binds two primary receptors with distinct effects:

  • FN14/TWEAKR: Mediates NF-κB activation (ED50 2-8 ng/mL in HUVEC assays)

  • Death Receptor 3 (DR3): Induces caspase-dependent apoptosis

Biological Activities

  • Angiogenesis: Stimulates endothelial cell proliferation (EC50 0.2-4.0 ng/mL)

  • Inflammation: Upregulates IL-8, CCL2, CXCL10 secretion

  • Dual Apoptotic Effects:

    • Pro-apoptotic in HT-29 adenocarcinoma (with IFN-γ)

    • Anti-apoptotic in NSCLC cell lines (A549, H1299)

Disease Modeling

  • Liver Fibrosis: Activates hepatic stellate cells at 10-100 ng/mL doses

  • Inflammatory Bowel Disease: Induces PDPN/ICAM-1 in colonic fibroblasts (50 ng/mL TWEAK)

  • Cancer Biology:

    • Promotes Calu-3 NSCLC metastasis (IC50 5 nM RG7212 antibody)

    • Enhances monocyte adhesion via VCAM-1 upregulation

Signaling Studies

TWEAK modulates three key pathways:

  1. Non-canonical NF-κB: NIK-dependent fibroblast activation

  2. MAPK Cascade: p38/JNK phosphorylation in endothelial cells

  3. PI3K-Akt: Survival signaling in tumor microenvironments

Clinical Relevance

ConditionTWEAK LevelTherapeutic Target Status
Chronic Hepatitis↑ Serum levelsPhase II anti-TWEAK mAbs
Colorectal Cancer↑ Tumor expressionPreclinical siRNA trials
Rheumatoid ArthritisSynovial fluid ↑Failed Phase I (RG7212)

Contradictory findings in NSCLC models highlight context-dependent effects, with TWEAK displaying both pro-tumorigenic and anti-metastatic properties based on microenvironmental factors .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your requests whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All protein shipments are sent with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag type requirements, please communicate them to us. We will prioritize developing the specified tag if possible.
Synonyms
APO 3 ligand; APO 3L; APO3 ligand; APO3/DR3 ligand; APO3L; DR3LG; MGC129581; MGC20669; secreted form; TNF-related weak inducer of apoptosis; TNF12_HUMAN; TNFSF 12; Tnfsf12; TNFSF12 protein; Tumor necrosis factor (ligand) superfamily member 12; Tumor necrosis factor ligand superfamily member 12; Tumor necrosis factor superfamily member 12; TWEAK; UNQ181/PRO207
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-249
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TNFSF12
Target Protein Sequence
MAARRSQRRRGRRGEPGTALLVPLALGLGLALACLGLLLAVVSLGSRASLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH
Uniprot No.

Target Background

Function
TNFSF12 binds to FN14 and potentially also to TNRFSF12/APO3. It is a weak inducer of apoptosis in certain cell types. TNFSF12 mediates NF-kappa-B activation, promotes angiogenesis and endothelial cell proliferation, and plays a role in the induction of inflammatory cytokines. It also promotes IL8 secretion.
Gene References Into Functions
  1. Observational study of gene-disease association. (HuGE Navigator) PMID: 19913121
  2. Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator) PMID: 20628086
Database Links

HGNC: 11927

OMIM: 602695

KEGG: hsa:407977

UniGene: Hs.54673

Protein Families
Tumor necrosis factor family
Subcellular Location
Cell membrane; Single-pass type II membrane protein.; [Tumor necrosis factor ligand superfamily member 12, secreted form]: Secreted.; [Isoform TWE-PRIL]: Cell membrane; Single-pass membrane protein.
Tissue Specificity
Highly expressed in adult heart, pancreas, skeletal muscle, brain, colon, small intestine, lung, ovary, prostate, spleen, lymph node, appendix and peripheral blood lymphocytes. Low expression in kidney, testis, liver, placenta, thymus and bone marrow. Als

Q&A

What is TNFSF12 and what are its alternative names?

TNFSF12 (Tumor necrosis factor ligand superfamily member 12) is also known as TNF-related weak inducer of apoptosis (TWEAK). It is a protein encoded by the TNFSF12 gene in humans that was first discovered in 1997 . It functions as a cytokine belonging to the tumor necrosis factor (TNF) ligand family and serves as a ligand for the FN14/TWEAKR receptor . While it shares signaling functions with TNF, TWEAK displays a notably wider tissue distribution pattern, allowing it to influence a broader range of biological processes .

What cell types express TNFSF12 and its receptor?

Leukocytes serve as the primary source of TWEAK, with expression detected in both resting and activated human monocytes, dendritic cells, and natural killer cells . The receptor for TWEAK, known as FN14/TWEAKR (TNFRSF12A), shows elevated expression in injured tissues and most solid tumor types . This expression pattern suggests that the TWEAK/Fn14 signaling axis becomes particularly active during tissue damage or in pathological states, pointing to its potential role in both physiological repair mechanisms and disease progression .

How is TNFSF12 detected in experimental settings?

TNFSF12 can be detected using various methods, with ELISA being particularly effective for native protein detection in biological samples. Commercially available ELISA kits employ the quantitative sandwich enzyme immunoassay technique, where antibodies specific for TWEAK are pre-coated onto microplates . These assays typically involve:

  • Sample application where any TWEAK present binds to immobilized antibodies

  • Addition of biotin-conjugated TWEAK-specific antibodies

  • Application of avidin-conjugated Horseradish Peroxidase (HRP)

  • Addition of substrate solution that develops color proportional to TWEAK concentration

  • Measurement of color intensity after stopping the reaction

Importantly, certain ELISA kits are specifically designed to detect native, not recombinant, TNFSF12 in undiluted body fluids and/or tissue homogenates .

What are the different forms of TNFSF12 and how are they processed?

TNFSF12 exists in two main forms: a membrane-anchored protein and a secreted isoform. The protein is initially synthesized in the membrane-bound form, but can undergo proteolytic processing by furin cleavage within the stalk region to generate the soluble, secreted form . Both forms are biologically active and can bind to the Fn14 receptor, though they may exhibit different potencies or tissue distributions. This dual presentation allows TWEAK to function both as a juxtacrine signal (membrane-bound form) and as an endocrine or paracrine signal (secreted form), expanding its range of influence in various biological contexts .

What signaling pathways are activated by TNFSF12-Fn14 interaction?

When TWEAK binds to Fn14, it triggers several complex signaling cascades:

  • Receptor association with adapters: Fn14, like other TNF receptor superfamily members, is not a ligand-activated protein kinase. Instead, TWEAK:Fn14 engagement promotes Fn14 association with members of the TNFR associated factor (TRAF) family of adapter proteins .

  • NF-κB pathway activation: This interaction triggers activation of both classical and alternative NF-κB pathways, which regulate numerous inflammatory and survival genes .

  • Cell death pathways: TWEAK can induce apoptosis via multiple cell death pathways in a cell type-specific manner, though this appears to be an indirect effect mediated by other cytokines in many cases .

  • Proliferative and migratory signals: TWEAK stimulates cellular responses including proliferation and migration, particularly in endothelial cells, contributing to its role in angiogenesis .

The complexity and context-dependency of these signaling outcomes highlight the need for careful experimental design when studying TWEAK-mediated effects.

What is known about TNFSF12's role in various disease states?

TNFSF12/TWEAK has been implicated in several pathological conditions:

This diverse involvement makes the TWEAK/Fn14 axis an attractive but complex therapeutic target.

How do genomic alterations affect TNFSF12 expression and function?

In cancer cohorts, genomic alterations in TNFSF12 have been reported in approximately 5% of cases . These alterations can affect expression levels and potentially protein function. Survival analysis reveals that TNFSF12's impact varies by cancer subtype and grade:

These findings suggest that the functional consequences of TNFSF12 alterations or expression changes are highly context-dependent and may be influenced by the broader molecular landscape of the specific disease state.

What are the optimal methods for producing recombinant TNFSF12 for research use?

When producing recombinant TNFSF12 for research applications, several key considerations should be addressed:

  • Expression system selection: Mammalian expression systems (such as HEK293 or CHO cells) are often preferred for human TNFSF12 production to ensure proper folding and post-translational modifications.

  • Construct design: Researchers should determine whether to express the full-length membrane-bound form or the soluble form (by removing the transmembrane domain). The choice depends on the specific research questions being investigated .

  • Purification strategy: Affinity tags (such as His-tag or Fc-fusion) can facilitate purification, but researchers must consider whether these tags might affect protein function and whether tag removal is necessary.

  • Activity testing: Functional assays should be employed to confirm that the recombinant protein retains biological activity, such as its ability to induce Fn14-dependent signaling in appropriate cell lines.

  • Storage conditions: To maintain stability, recombinant TNFSF12 is typically stored in buffer conditions that prevent aggregation, often with stabilizing agents and at -80°C for long-term storage.

Quality control should include verification of purity by SDS-PAGE, confirmation of identity by mass spectrometry, and endotoxin testing to ensure results aren't confounded by contaminants.

What considerations are important when designing experiments to study TNFSF12 function?

When designing experiments to study TNFSF12 function, researchers should consider:

  • Cell type selection: TWEAK effects are highly cell type-specific, with different outcomes observed in different cellular contexts . Choose cell types relevant to your research question and confirm expression of Fn14 receptor.

  • Concentration range: Determine appropriate concentration ranges based on literature and preliminary dose-response experiments. Effects may be biphasic depending on concentration.

  • Timing considerations: TWEAK can trigger both acute and chronic responses. Experimental duration should be tailored to capture the relevant temporal dynamics of the process being studied.

  • Specificity controls: Include appropriate controls such as:

    • Fn14 receptor blocking antibodies

    • TWEAK neutralizing antibodies

    • Receptor knockdown/knockout models

    • Inactive TWEAK mutants

  • Readout selection: Choose appropriate assays based on expected outcomes (apoptosis, proliferation, migration, NF-κB activation, cytokine secretion, etc.) .

  • In vivo models: Consider whether xenograft, syngeneic, or genetically modified animal models would best address your research question .

What are the challenges in measuring native TNFSF12 in biological samples?

Measuring native TNFSF12 in biological samples presents several technical challenges:

  • Protein levels: TWEAK may be present at very low concentrations in many biological samples, requiring highly sensitive detection methods.

  • Isoform specificity: Assays may detect both membrane-bound and soluble forms differently, potentially complicating interpretation of results.

  • Sample preparation: Proper sample collection, storage, and processing are crucial to preserve TWEAK protein integrity and prevent degradation.

  • Cross-reactivity: Ensuring antibody specificity is essential, as other TNF family members share structural similarities with TWEAK.

  • Detection method limitations:

    • ELISA kits designed for native TWEAK may not recognize recombinant forms

    • Western blotting may require optimization for sensitivity

    • Mass spectrometry approaches may need enrichment strategies

  • Reference standards: Establishing appropriate standards and controls for quantification is essential for reliable measurements.

To address these challenges, specialized ELISA kits have been developed specifically for native TNFSF12 detection in undiluted body fluids and tissue homogenates .

What therapeutic approaches targeting TNFSF12/Fn14 are under development?

Multiple therapeutic strategies targeting the TWEAK/Fn14 axis have been developed and some have advanced to clinical trials:

  • TWEAK-neutralizing agents:

    • RG7212 (RO5458640): A humanized anti-TWEAK-neutralizing monoclonal antibody that blocks TWEAK-stimulated proliferation, NF-κB activation, and cytokine secretion .

    • This antibody entered Phase I clinical trials (NCT01383733) with 38 Fn14-positive tumor patients and demonstrated tolerability with some efficacy in advanced solid tumors .

  • Fn14-directed agonistic antibodies:

    • Several antibodies (including BIIB036 and 18D1) have been developed to activate Fn14 signaling in tumor cells and promote cell death .

    • These agents may work through direct effects and antibody-dependent cellular cytotoxicity (ADCC) .

  • Fn14-targeted delivery systems:

    • Fn14-TRAIL fusion protein: This agent combines Fn14 targeting with TRAIL-induced apoptosis and has shown efficacy in hepatocellular carcinoma models .

    • Other approaches use Fn14 as a portal to deliver toxins or pro-apoptotic proteins into tumor cells .

The development of these diverse therapeutic approaches highlights the potential of the TWEAK/Fn14 axis as a treatment target for various diseases, particularly cancer.

How does TNFSF12 expression correlate with clinical outcomes in different diseases?

TNFSF12 expression correlates with clinical outcomes in disease-specific and context-dependent ways:

Understanding these correlations can help identify patient populations most likely to benefit from TWEAK/Fn14-targeted therapies.

What are the current gaps in our understanding of TNFSF12 biology?

Despite significant advances, several important gaps remain in our understanding of TNFSF12 biology:

  • Receptor interactions beyond Fn14: While Fn14 is the primary receptor, evidence suggests TWEAK may interact with other receptors like TNRFSF12/APO3, but these interactions are less well characterized .

  • Isoform-specific functions: The differential roles of membrane-bound versus soluble TWEAK forms need further clarification in various physiological and pathological contexts.

  • Context-dependent signaling outcomes: The molecular determinants that dictate whether TWEAK induces proliferation, migration, or cell death in different cell types remain incompletely understood.

  • Biomarker potential: Whether TNFSF12 levels in biological fluids can serve as reliable biomarkers for disease progression or treatment response requires further investigation.

  • Genetic regulation: The mechanisms controlling TNFSF12 gene expression in different tissues and disease states need further exploration.

  • Integration with other cytokine networks: How TWEAK signaling integrates with other inflammatory and immune signaling networks remains to be fully elucidated.

Addressing these knowledge gaps will be essential for fully harnessing the therapeutic potential of the TWEAK/Fn14 axis and developing more effective targeted interventions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.