Recombinant Human Tumor necrosis factor ligand superfamily member 14 (TNFSF14)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Tumor Necrosis Factor Ligand Superfamily Member 14 (TNFSF14)

Recombinant Human Tumor Necrosis Factor Ligand Superfamily Member 14, commonly referred to as TNFSF14 or LIGHT, is a protein belonging to the tumor necrosis factor (TNF) superfamily. It plays a crucial role in various biological processes, including immune responses and vascular normalization. This protein is recognized by receptors such as herpesvirus entry mediator (HVEM) and decoy receptor 3 (DcR3) .

Structure and Function of TNFSF14

TNFSF14 is a 240 amino acid protein that includes a cytoplasmic domain, a transmembrane region, and an extracellular domain. It is produced by activated T cells and can form homotrimers similar to other TNF ligand family members. The protein's ability to bind HVEM and LT beta receptor makes it a significant factor in modulating immune responses and apoptosis in tumor cells .

Biological Roles of TNFSF14

TNFSF14 functions as a costimulatory factor for lymphoid cell activation and can deter herpesvirus infections by competing with viral glycoproteins for receptor binding. It stimulates T cell proliferation and induces apoptosis in tumor cells, which can be enhanced by interferon-gamma (IFN-γ) . Additionally, TNFSF14 plays a role in vascular normalization, which is beneficial for cancer immunotherapy by improving drug delivery and immune cell infiltration into tumors .

Association with Cardiovascular Events

Recent studies have shown that elevated levels of TNFSF14 are associated with an increased risk of cardiovascular events in patients with stable coronary artery disease (CAD). This association suggests that TNFSF14 could serve as a novel biomarker for predicting cardiovascular outcomes in CAD patients .

Table 1: Characteristics of Discovery and Validation Cohorts in CAD Study

CharacteristicsDiscovery Cohort (Stable CAD) N=894Validation Cohort (Stable Multivessel CAD) N=126P Value
Age, y66.5±12.369.3±13.70.018
Men, n (%)766 (86)83 (66)<0.001
Smokers, n (%)491 (55)53 (42)0.007
Hypertension, n (%)588 (66)83 (66)0.982
Diabetes mellitus, n (%)340 (38)52 (41)0.484
Serum creatinine, mg/dL1.35±1.421.53±1.610.185
Lipid profile
Total Cholesterol, mg/dL162.0±35.4166.8±39.30.175
Triglyceride, mg/dL130.3±79.0128.6±101.60.862
HDL-C, mg/dL42.1±10.744.1±14.20.123
LDL-C, mg/dL93.5±28.393.5±28.3<0.001
HsCRP, mg/L0.37±0.950.89±1.740.001
TNFSF14, pg/mL123.0±230.4243.0±325.4<0.001

Table 2: Hazard Ratios for Predicting Cardiovascular Events

VariableCrude HR (95% CI)P ValueAdjusted HR* (95% CI)P Value
Circulating TNFSF14: per 100 pg/mL increment1.12 (1.06–1.18)<0.0011.11 (1.04–1.19)0.001
Age: per 1 y increment1.02 (0.99–1.05)0.238--
Sex: female vs male0.57 (0.25–1.32)0.188--
Active smoking: smokers vs nonsmokers1.16 (0.43–3.16)0.765--
History of hypertension: HTN vs non-HTN1.38 (0.54–3.54)0.498--
History of diabetes mellitus: DM vs non-DM1.87 (0.81–4.33)0.144--
Baseline serum creatinine: per 1 mg/dL increment1.04 (0.82–1.31)0.746--
Total cholesterol level: per 10 mg/dL increment1.03 (0.92–1.15)0.637--
LDL-cholesterol level: per 1 mg/dL increment1.01 (0.89–1.15)0.825--
HDL-cholesterol level: per 1 mg/dL increment0.76 (0.53–1.09)0.132--
Triglyceride level: per 1 mg/dL increment1.01 (0.97–1.05)0.626--
HsCRP level: per 1.0 mg/L increment1.26 (1.10–1.43)0.0011.24 (1.09–1.42)0.002

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method or location. Please contact your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
TNFSF14; HVEML; LIGHT; UNQ391/PRO726; Tumor necrosis factor ligand superfamily member 14; Herpes virus entry mediator ligand; HVEM-L; Herpesvirus entry mediator ligand; CD antigen CD258
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-240
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MEESVVRPSVFVVDGQTDIPFTRLGRSHRRQSCSVARVGLGLLLLLMGAGLAVQGWFLLQLHWRLGEMVTRLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV
Uniprot No.

Target Background

Function
Tumor necrosis factor ligand superfamily member 14 (TNFSF14), also known as LIGHT, is a cytokine that binds to TNF receptor superfamily member 3 (TNFRSF3)/LTBR. Binding to the decoy receptor TNFRSF6B modulates its effects. TNFSF14 acts as a ligand for TNFRSF14/HVEM. Upon binding to TNFRSF14/HVEM, it delivers costimulatory signals to T cells, resulting in T cell proliferation and IFNG production.
Gene References Into Functions
  1. This study provides compelling evidence that TNFSF14 is crucial in limiting key steps in the pathogenesis of metabolic syndrome and supports the development of TNFSF14 signaling agonists as potential therapeutics for obesity and type 2 diabetes. PMID: 29359470
  2. LIGHT is highly expressed and associated with severe inflammation in patients with coronary disease. LIGHT significantly enhances the inflammatory response in oxLDL-induced THP-1 macrophages. PMID: 28642135
  3. The interaction between LIGHT and LTBR promotes the survival and proliferation of human bone marrow-derived mesenchymal stem cells, suggesting a potential role for LIGHT in stem cell therapy. PMID: 27835685
  4. Serum LIGHT levels correlate with the progression and severity of interstitial pneumonia in patients with dermatomyositis. PMID: 26448572
  5. LIGHT, via LTbetaR signaling, may contribute to the exacerbation of airway neutrophilic inflammation through cytokine and chemokine production by bronchial epithelial cells. PMID: 25501580
  6. LIGHT controls TSLP to drive pulmonary fibrosis. PMID: 25680454
  7. The tumor necrosis factor superfamily molecule LIGHT promotes keratinocyte activity and skin fibrosis. PMID: 25789702
  8. Proliferation and migration are enhanced in Tca8113 cells with over-expressed TNFSF14. PMID: 26146063
  9. LIGHT, a TNF superfamily member, is involved in T-cell homeostasis and erosive bone disease associated with rheumatoid arthritis. PMID: 25460501
  10. Crystal structures of LIGHT and the LIGHT:DcR3 complex reveal the structural basis for the DcR3-mediated neutralization of LIGHT. PMID: 25087510
  11. Regulation by NK cell licensing helps safeguard against TNFSF14 production in response to healthy tissues. PMID: 25512551
  12. These findings suggest a new molecular determinant of LIGHT-mediated pathogenic changes in human bronchial epithelial cells. PMID: 25251281
  13. TNFSF14 has an effect on the activation of basophils and eosinophils interacting with bronchial epithelial cells. PMID: 24782592
  14. Triggering of LIGHT induced production of pro-inflammatory mediators such as interleukin-8 and matrix metalloproteinase-9 while suppressing the phagocytic activity. PMID: 24044961
  15. Individuals carrying GG genotypes of rs1077667 within the LIGHT gene, exhibiting the highest risk for Multiple Sclerosis, had the lowest serum levels. PMID: 23037546
  16. Although a limited number of activated T-cells infiltrate the tumor and initiate an immune response, the number of LIGHT+ T cells infiltrating the tumor is very low. PMID: 23514280
  17. Findings show that LIGHT is not inhibited by the soluble RANKL receptor OPG and that LIGHT is a potent osteoclastogenesis factor that activates the Akt, NFkappaB, and JNK pathways. PMID: 23391709
  18. TNFSF14 was significantly increased in sickle-cell anemia, SCA treated with hydroxycarbamide, and HbSC. It could contribute to endothelial activation and inflammation in SCA. PMID: 22775554
  19. This study showed that expression of the death-triggering ligand LIGHT is increased in ALS spinal cords. PMID: 22221541
  20. Increased plasma levels are observed in patients with atopic dermatitis. PMID: 22519595
  21. INF-gamma can synergistically precede LIGHT-induced apoptotic processes through down-regulation of Bcl-2 expression, but not survivin expression. PMID: 21117871
  22. These data clearly indicate that ZFP91 is a key regulator in LIGHT-induced activation of the non-canonical NF-kappaB pathway in LTbetaR signaling. PMID: 20804734
  23. Herpes simplex virus 1 gD interferes with HVEM function by competing with its natural ligands and by downregulating HVEM. PMID: 20826693
  24. Increased potential for LIGHT receptor signaling, coupled with increased bioavailability due to lower decoy receptor-3 (DcR3) avidity, provides a mechanism for polymorphic variants in LIGHT to contribute to the pathogenesis of inflammatory diseases. PMID: 20592286
  25. Mediates organ-specific donor T cells activation in GVHD. PMID: 19826934
  26. Suppresses tumor growth by augmenting the immune response. PMID: 19716382
  27. There is overexpression of genes related to immune and inflammatory responses, including cytokines such as TNFSF14 in interstitial cystitis. PMID: 20096889
  28. When highly expressed, LIGHT is capable of promoting effector T cell proliferation and differentiation even in a regulatory T (Treg) cell-enriched, suppressive intestinal environment. PMID: 20042587
  29. These findings suggest that LIGHT might be involved in the progression of inflammatory bone destruction in rheumatoid arthritis. PMID: 19019090
  30. Effects in transgenic mice indicate that human LIGHT may function as a major regulator of T cell activation, and implicate LIGHT signaling pathways in inflammation focused on mucosal tissues. PMID: 11714797
  31. LIGHT (TNFSF14), its membrane-anchored ligand, was also present in atheromatous lesions and highest in regions rich in macrophage-derived foam cells. PMID: 11742858
  32. Role of the calcium-signaling pathway in the transcriptional control. PMID: 12215452
  33. LIGHT may act as an anti-apoptotic agent against TNFalpha-mediated liver injury by blocking the activation of both caspase-3 and caspase-8. PMID: 12393901
  34. LIGHT, a new member of the TNF superfamily [review]. PMID: 12456019
  35. Data show that mRNA encoding LIGHT and its receptors [HVEM, LTbetaR, and TR6 (DcR3)] are present in placentas and cytotrophoblast cells at term. PMID: 12466117
  36. Soluble LIGHT blocks TR6-Fc costimulated proliferation, lymphokine production, and cytotoxicity of T cells in the presence of T cell receptor ligation. PMID: 12471113
  37. LIGHT-sensitized IFN-gamma-mediated apoptosis of MDA-MB-231 cells is probably through down-regulation of anti-apoptosis Bcl-2 family members; it could be caspase (especially caspase-3)-independent, even though extensive caspase activation was observed. PMID: 12767529
  38. LIGHT signaling is mediated through both death receptor and mitochondria pathways. PMID: 15115612
  39. LIGHT-herpesvirus entry mediator mediated signaling as an important immune regulatory mechanism in mucosal inflammatory responses. PMID: 15210782
  40. Mechanisms protecting trophoblast cells from LIGHT-mediated apoptosis were studied. PMID: 15215185
  41. LIGHT expression by human intestinal T cells suggests the possibility that LIGHT may play a key role in regulating the mucosal immune system. PMID: 15634882
  42. LIGHT protein can be activated on mucosal T cells through a gut-specific CD2-dependent signaling mechanism. PMID: 15634882
  43. Data suggest that LIGHT constitutively expressed in human melanoma cells and microvesicles may contribute to regulating T-cell responses to tumor cells. PMID: 15833878
  44. NF-kappaB signaling plays a key role in LIGHT-mediated upregulation of CD86 expression. PMID: 15895390
  45. Both LTbetaR and HVEM can discriminatively mediate the expression of different genes in cultured human umbilical vein endothelial cells, including LIGHT, a proinflammatory cytokine. PMID: 15917993
  46. A transgenic mouse model resembling Crohn's disease (CD) suggests that up-regulation of LIGHT may be an important mediator of CD pathogenesis. PMID: 15944326
  47. LIGHT could serve as a molecular link between lipid metabolism, inflammation, and thrombus formation, which are all features of atherosclerotic plaques. PMID: 16186421
  48. Platelet-derived LIGHT is biologically active and can induce an inflammatory response in monocytes and particularly within endothelial cells, measured as up-regulation of adhesion molecules and release of chemokines. PMID: 16861346
  49. Blockade of TNFSF14 signaling caused a substantial reduction in the expression of lymphotoxin beta receptor (LTbetaR)-controlled migration factors within the islets and disrupts organization of tertiary structures, leading to prevention of diabetes. PMID: 16934497
  50. The LIGHT system may regulate early to middle stages of placental development via cell-specific, temporally programmed expression of the ligand and its receptors, and may also assist in preserving placental immune privilege. PMID: 17010447

Show More

Hide All

Database Links

HGNC: 11930

OMIM: 604520

KEGG: hsa:8740

STRING: 9606.ENSP00000469049

UniGene: Hs.129708

Protein Families
Tumor necrosis factor family
Subcellular Location
[Tumor necrosis factor ligand superfamily member 14, membrane form]: Cell membrane; Single-pass type II membrane protein.; [Tumor necrosis factor ligand superfamily member 14, soluble form]: Secreted.; [Isoform 2]: Cytoplasm.
Tissue Specificity
Predominantly expressed in the spleen but also found in the brain. Weakly expressed in peripheral lymphoid tissues and in heart, placenta, liver, lung, appendix, and kidney, and no expression seen in fetal tissues, endocrine glands, or nonhematopoietic tu

Q&A

What is the basic structure and function of TNFSF14?

TNFSF14, also known as LIGHT, is a type II transmembrane protein belonging to the tumor necrosis factor superfamily. It contains a TNF homology domain and functions as a ligand for receptors including lymphotoxin receptor (LTR) and herpesvirus entry mediator (HVEM/TNFRSF14). TNFSF14 is highly expressed in multiple immune cells, including resting and activated T cells, B cells, monocytes, and macrophages . Functionally, TNFSF14 plays critical roles in mediating cell apoptosis, proliferation, activation, and differentiation, particularly in immune and inflammatory responses .

To study its structure, researchers typically employ X-ray crystallography or in silico approaches to identify key binding regions. For instance, computational methods have successfully identified specific residues in TNFSF14 that contribute to receptor binding, enabling the development of peptide mimics with therapeutic potential .

What are the established methodologies for producing and purifying recombinant TNFSF14?

Recombinant TNFSF14 production typically involves:

  • Gene cloning of human TNFSF14 into expression vectors

  • Transformation into expression systems (commonly E. coli, mammalian cells like HEK293, or insect cells)

  • Induction of protein expression

  • Purification via affinity chromatography (often using His-tag or GST-tag systems)

  • Secondary purification steps such as size exclusion or ion exchange chromatography

  • Quality control assessment via SDS-PAGE, Western blotting, and bioactivity assays

For solubility optimization, researchers often use fusion tags or solubility enhancers, with careful selection of buffer systems containing stabilizing agents. Activity validation should include binding assays with TNFRSF14/HVEM and LTβR receptors using surface plasmon resonance or ELISA-based methods .

How do TNFSF14 levels differ between healthy individuals and those with metabolic or inflammatory disorders?

TNFSF14 expression patterns vary significantly between healthy and disease states. In metabolic disorders, serum TNFSF14 levels are increased in morbidly obese individuals, and expression is reduced in non-T2D patients compared to T2D patients . This differential expression raises important questions about whether TNFSF14 upregulation during obesity acts in a pro- or anti-obesogenic manner.

In cardiovascular disease, elevated circulating TNFSF14 levels independently associate with increased risk of cardiovascular events in patients with stable coronary artery disease (CAD) . Similarly, TNFSF14 levels are significantly increased in both unilateral ureteral obstruction (UUO)-induced renal fibrotic mice and patients with fibrotic nephropathy compared to controls .

For inflammatory conditions, increased TNFSF14 expression has been observed in neutrophils and macrophages of HAdV55 infection patients versus controls, suggesting its role as an inflammatory biomarker .

Research methodology for measuring TNFSF14 typically involves ELISA for serum/plasma samples, qPCR for mRNA expression, and immunohistochemistry for tissue localization. When designing such studies, researchers should account for confounding variables including age, sex, comorbidities, and medication use.

What are the key signaling pathways influenced by TNFSF14, and how do they differ across tissue types?

TNFSF14 engages multiple signaling pathways with tissue-specific effects. In skeletal muscle, TNFSF14 and its derived peptides enhance insulin signaling pathways as evidenced by increased phospho-AKT expression . TNFSF14 peptides also promote fatty acid oxidation signaling in both skeletal muscle and liver tissues, with particularly notable effects on AMPK phosphorylation .

In renal tissue, TNFSF14 upregulates sphingosine kinase 1 (Sphk1) expression, which appears to be a critical mechanism underlying TNFSF14-mediated renal fibrosis . Sphk1 is a well-established pro-fibrotic factor, suggesting a direct mechanistic link between TNFSF14 signaling and fibrotic outcomes.

In immune contexts, TNFSF14 binding to HVEM/TNFRSF14 or LTβR stimulates T cells and innate immune responses . During respiratory virus infections, TNFSF14 promotes the generation of circulating and lung-resident memory CD8+ T cells, with enhanced expression in neutrophils and macrophages .

To effectively study these pathways, researchers should employ phospho-specific antibodies for Western blotting, RNA-seq for transcriptional profiling, and specific pathway inhibitors to confirm signaling relationships. Tissue-specific conditional knockout models would be valuable for dissecting context-dependent functions.

What are the contradictory findings regarding TNFSF14's role in metabolic syndrome and how might these be reconciled?

The literature presents contradictory findings regarding TNFSF14's role in metabolic syndrome:

Study Findings Supporting Protective RoleStudy Findings Supporting Detrimental Role
TNFSF14 ablation exacerbates high fat diet-induced obesity and pre-diabetes Increased serum TNFSF14 levels in morbidly obese humans
TNFSF14 treatment of human primary adipocytes inhibits adipocyte differentiation Higher TNFSF14 expression in T2D patients compared to non-T2D
TNFSF14-derived peptides improve glucose tolerance and insulin sensitivity One study reported TNFSF14 deficiency restored glucose homeostasis and reduced hepatic inflammation

These contradictions might be reconciled through several methodological approaches:

  • Timing considerations: TNFSF14 might have different effects during initiation versus progression of metabolic dysfunction

  • Tissue-specific analysis: Effects may differ between adipose tissue, liver, and skeletal muscle

  • Receptor-specific signaling: Different outcomes may result from engagement with HVEM/TNFRSF14 versus LTβR

  • Concentration-dependent effects: Physiological versus pathological levels may trigger different pathways

  • Source considerations: Differences between endogenous TNFSF14 and recombinant or peptide treatments

Future research should employ tissue-specific knockout models, receptor-specific blocking antibodies, and careful dose-response studies to address these contradictions .

How do TNFSF14-derived peptides compare with full-length TNFSF14 in terms of receptor binding affinity and biological effects?

TNFSF14-derived peptides represent a novel therapeutic approach that offers potential advantages over full-length protein. Through in silico approaches, key regions of TNFSF14 responsible for binding to HVEM/TNFRSF14 and LTβR have been identified, enabling the development of optimized peptides with improved affinity, solubility, and fold stability .

The TNFSF14 peptide sequences identified and their modifications include:

PeptideResidue Numbers in TNFSF14Sequence
198-117GANASLIGIGGPLLWETRLG
2166-180LYKRTSRYPKELELL
3219-228PGNRLVRPRD

Further optimization yielded peptides with differential binding affinities at different receptor sites:

PeptideSite 1Site 2Δ Affinity for TNFRSF14 at Site 1Δ Affinity for TNFRSF14 at Site 2Δ Affinity for LTβR at Site 1Δ Affinity for LTβR at Site 2
2.1Leu1Leu14-1.32-0.70-0.24-0.25
2.2Leu1Leu15-1.32-1.75-0.24-0.82

In functional studies, select peptides (particularly Peptide 7) demonstrate biological activities similar to full-length TNFSF14, including enhanced insulin and fatty acid oxidation signaling in skeletal muscle cells, reduced high fat diet-induced glucose intolerance, and decreased liver steatosis .

To compare peptides with full-length protein, researchers should conduct comprehensive receptor binding assays, signaling pathway activation studies, and in vivo efficacy comparisons using standardized metabolic phenotyping protocols.

What are the optimal animal models for studying TNFSF14's role in metabolic disorders?

When designing animal studies to investigate TNFSF14 in metabolic disorders, several validated models offer distinct advantages:

  • Diet-induced obesity (DIO) models:

    • High-fat diet (HFD) feeding (typically 45-60% calories from fat)

    • Duration: 12-16 weeks for robust metabolic phenotypes

    • Endpoints: body weight, glucose tolerance, insulin sensitivity, hepatic steatosis, adipocyte hypertrophy

  • Genetic models:

    • TNFSF14 knockout mice (global or conditional)

    • Tissue-specific overexpression using Cre-loxP systems

    • Receptor knockout models (HVEM/TNFRSF14 or LTβR)

  • Intervention approaches:

    • Administration of recombinant TNFSF14 or derived peptides

    • Receptor blocking antibodies

    • Viral vector-mediated gene delivery

Previous research has established that TNFSF14 ablation promotes high fat diet-induced obesity, glucose intolerance, insulin resistance, hyperinsulinemia, liver steatosis, and adipocyte hypertrophy and inflammation . Administration of TNFSF14 peptides, particularly Peptide 7, has shown efficacy in reducing these metabolic abnormalities .

For comprehensive metabolic phenotyping, researchers should measure:

  • Glucose tolerance (GTT) and insulin tolerance (ITT)

  • Hyperinsulinemic-euglycemic clamp for definitive insulin sensitivity assessment

  • Tissue-specific insulin signaling (pAKT/AKT ratios)

  • Energy expenditure and substrate utilization via metabolic chambers

  • Inflammatory markers in adipose tissue and circulation

What methodological considerations are important when measuring TNFSF14 as a biomarker in clinical studies?

When designing clinical studies utilizing TNFSF14 as a biomarker, researchers should address several methodological considerations:

  • Sample collection and processing:

    • Standardize collection procedures (time of day, fasting status)

    • Process samples within 2 hours of collection

    • Use appropriate anticoagulants (EDTA for plasma)

    • Centrifugation protocols should be consistent

    • Store at -80°C with minimal freeze-thaw cycles

  • Measurement techniques:

    • Commercial ELISA kits should be validated with recombinant standards

    • Consider multiplexed assays when examining multiple TNFSF members

    • Western blotting for tissue expression with appropriate controls

    • qPCR for mRNA expression with validated housekeeping genes

  • Study design considerations:

    • Prospective cohort designs offer stronger evidence than cross-sectional studies

    • Include appropriate matched controls

    • Power calculations should account for expected effect sizes (previous studies suggest hazard ratios around 1.11-1.14 for cardiovascular outcomes)

    • Consider longitudinal measurements to assess temporal changes

  • Confounding variables to control for:

    • Age, sex, BMI, comorbidities

    • Medications (particularly anti-inflammatory drugs)

    • Recent infections or inflammatory conditions

    • Renal function (as TNFSF14 may be influenced by kidney disease)

  • Statistical analysis:

    • Consider TNFSF14 as both continuous and categorical variable

    • Evaluate non-linear relationships

    • Adjust for multiple testing when examining multiple biomarkers

Previous clinical studies have demonstrated the prognostic value of TNFSF14 in CAD patients, where increased levels were independently associated with cardiovascular events after multivariate adjustment (adjusted hazard ratio, 1.14; 95% CI, 1.04–1.25) .

What are the most effective methods for analyzing TNFSF14's effects on cell signaling pathways in various tissue types?

Analysis of TNFSF14's effects on cell signaling requires comprehensive approaches across different tissue contexts:

  • In vitro cellular models:

    • Skeletal muscle: L6 myotubes or C2C12 cells

    • Adipocytes: 3T3-L1 cells or primary adipocytes

    • Hepatocytes: HepG2 cells or primary hepatocytes

    • Renal: Primary mouse renal tubular epithelial cells (mTECs)

    • Immune cells: Primary T cells, B cells, macrophages

  • Signaling pathway analysis techniques:

    • Phospho-protein analysis: Western blotting with phospho-specific antibodies for key nodes (AKT, AMPK, ERK)

    • Multi-pathway analysis: Phospho-antibody arrays or mass spectrometry-based phosphoproteomics

    • Real-time signaling: FRET-based biosensors or calcium imaging

    • Transcriptional responses: RNA-seq or targeted qPCR panels

    • Proteomics: Quantitative mass spectrometry with TMT labeling

  • Validation approaches:

    • Pathway inhibitors to confirm signaling relationships

    • siRNA/shRNA knockdown of pathway components

    • CRISPR/Cas9-mediated gene editing

    • Receptor-specific blocking antibodies to distinguish HVEM/TNFRSF14 vs. LTβR signaling

  • Tissue-specific considerations:

    • Skeletal muscle: Focus on insulin signaling (pAKT) and fatty acid oxidation (pAMPK)

    • Liver: Evaluate lipid metabolism pathways and Sphk1 expression

    • Kidney: Emphasize fibrotic pathways and Sphk1 activation

    • Immune cells: Assess activation markers and cytokine production

  • Data integration:

    • Network analysis to identify signaling hubs

    • Pathway enrichment analysis

    • Integration with publicly available datasets

    • Validation across multiple experimental systems

Previous research has established that TNFSF14 peptides increase insulin signaling (phospho-AKT) and fatty acid oxidation signaling (phospho-AMPK) in skeletal muscle cells , while also upregulating Sphk1 expression in renal cells .

How do the therapeutic applications of TNFSF14-derived peptides differ across metabolic, cardiovascular, and inflammatory disorders?

TNFSF14-derived peptides show promising therapeutic potential across diverse pathological conditions, with distinct mechanisms and applications:

  • Metabolic disorders:

    • TNFSF14 peptides (particularly Peptide 7) reduce high fat diet-induced glucose intolerance, insulin resistance, and hyperinsulinemia

    • Mechanisms include enhanced insulin signaling in skeletal muscle and increased fatty acid oxidation signaling

    • Additional effects include reduced liver steatosis and decreased SGLT2 expression

    • Therapeutic application: Potential novel anti-diabetic agents for treating obesity and T2D

  • Cardiovascular disease:

    • TNFSF14 levels predict cardiovascular events in patients with stable CAD

    • Unlike metabolic disorders, elevated TNFSF14 appears detrimental in cardiovascular contexts

    • Therapeutic application: Potential target for inhibition rather than supplementation

  • Renal fibrosis:

    • TNFSF14 functions as a pro-fibrotic factor in kidney disease

    • Mechanistically operates through upregulation of Sphk1 expression

    • Therapeutic application: Inhibiting TNFSF14 or its downstream signaling might reduce renal fibrosis

  • Inflammatory conditions:

    • TNFSF14 functions as an inflammatory indicator in severe HAdV pneumonia

    • Plays roles in limiting disease progression in multiple inflammatory and autoimmune conditions

    • Therapeutic application: Context-dependent modulation based on specific disease pathology

These differential applications highlight the importance of context-specific targeting and careful consideration of dose, timing, and delivery methods. Future therapeutic development should focus on tissue-specific delivery systems and receptor-selective peptide variants to maximize beneficial effects while minimizing potential adverse outcomes across different disease states.

What experimental approaches are most appropriate for evaluating the anti-diabetic efficacy of TNFSF14 peptides?

Rigorous evaluation of TNFSF14 peptides as anti-diabetic agents requires a multi-layered experimental approach:

  • In vitro screening cascade:

    • Cell-based insulin signaling assays in skeletal muscle cells (L6 or C2C12)

    • Glucose uptake assays using 2-deoxyglucose

    • Fatty acid oxidation measurements

    • Hepatocyte glucose production assays

    • Adipocyte differentiation and lipid accumulation assessment

  • Ex vivo tissue evaluation:

    • Insulin-stimulated glucose uptake in isolated skeletal muscle

    • Lipolysis inhibition in adipose tissue explants

    • Substrate metabolism in precision-cut liver slices

  • In vivo metabolic testing:

    • Glucose tolerance tests (GTT) to assess glucose handling

    • Insulin tolerance tests (ITT) to measure insulin sensitivity

    • Hyperinsulinemic-euglycemic clamp for definitive assessment of insulin sensitivity

    • Tracer studies to determine tissue-specific glucose disposal

    • Continuous glucose monitoring for detailed glycemic profiles

  • Safety and toxicity evaluation:

    • Comprehensive toxicology panel (liver, kidney function)

    • Immunogenicity assessment

    • Cardiovascular safety monitoring

    • Dose-ranging studies to determine therapeutic window

  • Comparison with standard-of-care:

    • Head-to-head comparisons with established anti-diabetic medications

    • Combination therapy assessment

Previous research has demonstrated that TNFSF14 Peptide 7 reduces high fat diet-induced glucose intolerance, insulin resistance, and hyperinsulinemia in mouse models of obesity . Additionally, TNFSF14 peptides increase insulin signaling and fatty acid oxidation signaling in skeletal muscle cells and liver tissue .

Key outcome measures should include HbA1c reduction, fasting and postprandial glucose levels, insulin sensitivity indices, beta-cell function markers, and metabolic biomarkers such as lipid profiles and inflammatory markers.

How can conflicting data on TNFSF14's role in hepatic inflammation and steatosis be resolved through experimental design?

To resolve conflicting findings regarding TNFSF14's role in hepatic inflammation and steatosis, researchers should implement a comprehensive experimental design addressing temporal, mechanistic, and contextual factors:

  • Temporal dynamics investigation:

    • Time-course studies with multiple assessment points

    • Inducible knockout models to distinguish development vs. progression

    • Sequential tissue sampling to track molecular changes over time

  • Mechanistic dissection:

    • Cell type-specific conditional knockout models:

      • Hepatocyte-specific (Albumin-Cre)

      • Macrophage-specific (LysM-Cre)

      • Stellate cell-specific (GFAP-Cre)

    • Receptor-specific approaches:

      • HVEM/TNFRSF14 vs. LTβR blockade

      • Receptor-selective peptide variants

  • Context-dependent modulation:

    • Dietary context variation:

      • High-fat diet vs. methionine-choline deficient diet

      • Western diet vs. high-fructose diet

    • Inflammatory context:

      • Sterile inflammation vs. pathogen-induced

      • Acute vs. chronic stimulation

  • Comprehensive phenotyping:

    • Histological assessment (H&E, Oil Red O, Sirius Red)

    • Inflammatory marker profiling (flow cytometry, cytokine arrays)

    • Metabolomic analysis of lipid species

    • Transcriptomic profiling with pathway analysis

    • Liver function tests and serum markers

  • Translational validation:

    • Human tissue samples from varying disease stages

    • Correlation with clinical biomarkers

    • In vitro validation using human hepatocytes

One study reported that TNFSF14 deficiency restored glucose homeostasis and reduced hepatic inflammation and steatosis , while other research found that TNFSF14 peptide treatment reduced liver steatosis with a concomitant increase in phospho-AMPK signaling . These contradictions might be resolved by examining metabolic context, dose-dependent effects, and pathway-specific responses.

This comprehensive approach would help determine whether TNFSF14 has context-dependent, temporal-specific, or pathway-selective effects in hepatic pathology, resolving current contradictions in the literature.

What emerging technologies could advance our understanding of TNFSF14 signaling networks?

Several cutting-edge technologies offer promising approaches to better understand TNFSF14 signaling networks:

  • Single-cell multi-omics:

    • Single-cell RNA-seq to identify cell-specific responses to TNFSF14

    • Single-cell ATAC-seq to map chromatin accessibility changes

    • Spatial transcriptomics to preserve tissue architecture context

    • Integration of multiple single-cell datasets for comprehensive signaling maps

  • Advanced protein interaction technologies:

    • Proximity labeling methods (BioID, APEX) to map TNFSF14 protein interaction networks

    • Hydrogen-deuterium exchange mass spectrometry for structural dynamics

    • AlphaFold2 and other AI-based structural prediction to model receptor-ligand interactions

    • CRISPR-based genetic screens to identify new pathway components

  • Live cell signaling visualization:

    • Optogenetic control of TNFSF14 signaling

    • Genetically encoded biosensors for real-time pathway activation

    • Super-resolution microscopy to track receptor clustering and trafficking

    • Intravital microscopy for in vivo signaling dynamics

  • Systems biology approaches:

    • Mathematical modeling of TNFSF14 signaling networks

    • Integration of multi-omics data through machine learning

    • Network analysis to identify central nodes and feedback loops

    • Pathway flux analysis to quantify signaling dynamics

  • Precision genome editing:

    • Base editing or prime editing for specific point mutations

    • Knockin reporter systems at endogenous loci

    • Receptor domain swapping to dissect binding interfaces

    • Tissue-specific inducible expression systems

These technologies would help address key questions regarding the context-dependent effects of TNFSF14 across different tissues and disease states, potentially resolving current contradictions in the literature regarding its role in metabolic disorders, cardiovascular disease, and inflammatory conditions .

How might receptor-selective TNFSF14 variants improve therapeutic targeting?

Development of receptor-selective TNFSF14 variants represents a promising approach to improve therapeutic specificity:

  • Rationale for receptor selectivity:

    • TNFSF14 binds to multiple receptors (HVEM/TNFRSF14 and LTβR) with differing downstream effects

    • HVEM/TNFRSF14 binding primarily mediates immune cell activation

    • LTβR signaling influences structural organization of lymphoid tissues and inflammation

    • Selective targeting could separate beneficial metabolic effects from potential inflammatory consequences

  • Design strategies for receptor-selective variants:

    • Structure-guided mutagenesis of receptor binding interfaces

    • Computational design of receptor-specific peptides

    • Yeast or phage display screening for selective binders

    • Domain swapping with other TNFSF members with known receptor selectivity

  • Validation approaches:

    • Binding assays with recombinant receptors (SPR, BLI)

    • Cell-based reporter systems for receptor-specific signaling

    • Receptor knockout cells to confirm specificity

    • Competitive binding assays with wild-type TNFSF14

  • Tissue-specific targeting strategies:

    • Receptor expression profiling across tissues

    • Conjugation with tissue-targeting antibodies or peptides

    • Nanoparticle-based delivery to specific organs

    • Stimuli-responsive release systems

  • Potential therapeutic applications:

    • HVEM/TNFRSF14-selective variants for immune modulation

    • LTβR-selective variants for metabolic disorders

    • Receptor antagonists for inflammatory conditions

    • Dual-specificity variants with balanced activity profiles

Current peptide design approaches have already identified TNFSF14-derived peptides with differential binding affinities for TNFRSF14 and LTβR at different binding sites . Further refinement of these approaches could yield highly selective therapeutic candidates with improved efficacy and reduced off-target effects.

What implications does TNFSF14 research have for understanding the interconnections between metabolism, inflammation, and tissue fibrosis?

TNFSF14 research provides a unique window into the complex interconnections between metabolism, inflammation, and tissue fibrosis:

  • Metabolic-inflammatory interface:

    • TNFSF14 modulates both metabolic pathways (insulin signaling, fatty acid oxidation) and inflammatory responses

    • This dual role exemplifies how metabolic signals can directly influence immune cell function

    • Research suggests TNFSF14 may act as a metabolic stress sensor that triggers appropriate immune responses

    • Future studies should investigate how metabolic perturbations alter TNFSF14 expression and signaling in immune cells

  • Inflammation-fibrosis axis:

    • TNFSF14 functions as a pro-fibrotic factor in renal fibrosis, mediated through Sphk1 upregulation

    • This suggests TNFSF14 may be part of the inflammatory cascade that initiates and sustains fibrotic responses

    • Similar mechanisms may operate in other fibrotic diseases (liver, lung, heart)

    • Research should explore the temporal dynamics of TNFSF14 expression during transition from inflammation to fibrosis

  • Tissue-specific regulatory networks:

    • TNFSF14 exhibits tissue-specific effects:

      • Beneficial metabolic effects in skeletal muscle and liver

      • Detrimental fibrotic effects in kidney

      • Context-dependent effects in immune tissues

    • These differential responses likely reflect tissue-specific receptor expression and downstream signaling networks

    • Integrated multi-tissue analysis could reveal how TNFSF14 coordinates whole-body responses

  • Therapeutic implications:

    • Understanding these interconnections will facilitate development of targeted therapies

    • Potential for tissue-specific modulation to achieve desired effects while minimizing adverse outcomes

    • Combination approaches targeting multiple aspects of these interconnected pathways

  • Future research directions:

    • Multi-tissue transcriptional profiling after TNFSF14 administration

    • Metabolic phenotyping of tissue-specific TNFSF14 or receptor knockout models

    • Assessment of fibrotic markers in metabolic disease models with TNFSF14 modulation

    • Longitudinal studies tracking progression from inflammation to fibrosis

By continuing to investigate TNFSF14's diverse roles, researchers will gain deeper insights into the fundamental biological mechanisms connecting metabolic dysfunction, inflammatory responses, and pathological tissue remodeling, potentially opening new therapeutic avenues for multiple disease states .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.