Recombinant Human Tumor necrosis factor ligand superfamily member 15 (TNFSF15)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is defined during production. If a specific tag is required, please inform us, and we will prioritize its development.
Synonyms
TNFSF15; TL1; VEGI; Tumor necrosis factor ligand superfamily member 15; TNF ligand-related molecule 1; Vascular endothelial cell growth inhibitor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-251
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MAEDLGLSFGETASVEMLPEHGSCRPKARSSSARWALTCCLVLLPFLAGLTTYLLVSQLRAQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Uniprot No.

Target Background

Function
Receptor for TNFRSF25 and TNFRSF6B. It mediates NF-κB activation, inhibits vascular endothelial growth and angiogenesis (in vitro), and promotes caspase activation and apoptosis.
Gene References Into Functions
  1. TNFSF15 polymorphisms may contribute to the genetic susceptibility of inflammatory bowel disease (Meta-Analysis). PMID: 29873318
  2. TL1A modulates rheumatoid arthritis fibroblast-like synoviocytes migration and Indian hedgehog signaling pathway using TNFR2. PMID: 29748156
  3. TL1A can induce tumor cell proliferation and promote colitis-associated colorectal cancer by activating the Wnt/β-catenin pathway. PMID: 29796912
  4. TNFSF15, primarily produced by blood endothelial cells, facilitates tumor lymphangiogenesis by upregulating VEGFC expression in A549 cells. PMID: 29890027
  5. TNFSF15 SNPs (rs3810936 and rs4979462) may confer susceptibility to systemic lupus erythematosus (SLE) risk and are associated with SLE clinical phenotypes. PMID: 29803925
  6. Three alternatively spliced VEGI isoforms (VEGI174, VEGI192, and VEGI251) exist. This study investigated the effects of VEGI174 and its functional domains (V7 and V8) on epithelial-mesenchymal transition (EMT) in renal cell carcinoma (RCC) cells in vitro. VEGI174, V7, or V8 overexpression inhibited EMT. PMID: 28656288
  7. Evidence suggests that TNFSF15 variance affects cytokine expression across various tissues, contributing to protection from infectious diseases (e.g., leprosy) while increasing the risk of immune-mediated diseases (e.g., Crohn's disease and primary biliary cholangitis). PMID: 27507062
  8. Single variant analysis identified a novel psoriasis risk locus at TNFSF15 (rs6478108). PMID: 28973304
  9. TNFSF15 plays a role in the development of systemic sclerosis. PMID: 28397078
  10. The DR3/TL1A pathway enhances human osteoclast formation and resorptive activity, controlling the expression and activation of CCL3 and MMP-9. PMID: 28062298
  11. Blocking tumor necrosis factor receptor 2 (TNFR2) decreased TL1A-stimulated IL-6 production by rheumatoid arthritis fibroblast-like synoviocytes. PMID: 27081759
  12. Distinct but overlapping TNFSF15 haplotypes were observed in diverticulitis patients versus healthy controls, suggesting similar but distinct genetic predispositions. This study supports a genetic predisposition to diverticulitis involving the TNFSF15 gene. PMID: 28624054
  13. TL1A differentially induces the expression of TH17 effector cytokines (IL-17, -9, and -22), representing a potential therapeutic target in TH17-driven chronic inflammatory diseases. PMID: 27733581
  14. VEGI174 prevents progression and tumor metastasis by inhibiting epithelial-mesenchymal transition (EMT) in renal cell carcinoma (RCC) in vivo, suggesting a potential new treatment approach for RCC. PMID: 28739718
  15. Human regulatory T-lymphocytes express DR3 and demonstrate DR3/TL1A-mediated signaling activation via MAP kinases and NF-κB (DR3 = death receptor 3; TL1A/TNFSF15 = tumor necrosis factor [ligand] superfamily, member 15). PMID: 28337757
  16. These results suggest the involvement of TL1A/DR3/DR3-mediated mechanisms in epithelial-mesenchymal interactions and the development of inflammation-induced intestinal fibrosis in Crohn's disease. PMID: 27665176
  17. rs1250569 (ZMIZ1) and rs10114470 (TL1A) are novel loci indicating susceptibility to inflammatory bowel disease in Han-Chinese patients. PMID: 28456797
  18. Genetic susceptibility of TNFSF15 to Crohn's disease may be influenced by increased Prevotella. PMID: 28197769
  19. Re-NGR-VEGI has potential as a theranostic agent. PMID: 26768609
  20. miRNA-31 directly binds to the 3'-UTR of TNFSF15, negatively regulating its expression in Caco2 cells. PMID: 27188743
  21. Significant associations exist between rs3810936, rs6478108, rs6478109, and rs7848647 of TNFSF15 and Crohn's disease in Korean pediatric patients. PMID: 25998826
  22. Patients with mild traumatic brain injury (TBI) exhibited higher VEGI levels than those with moderate and severe TBI. PMID: 26945876
  23. Biologics beyond TNF-α inhibitors and the effect of targeting the homologous TL1A-DR3 pathway in chronic inflammatory disorders. PMID: 26810853
  24. Rs3810936 of TNFSF15 is related to ankylosing spondylitis risk. PMID: 26823868
  25. Higher TL1A levels are associated with early-stage chronic lymphocytic leukemia. PMID: 26393680
  26. TL1A-induced cell death is directly mediated through DR3. PMID: 26509650
  27. Plasma TL1A levels are significantly higher in newly diagnosed SLE patients compared to controls and are positively associated with SLE disease activity index. PMID: 25929716
  28. HDAC inhibitors may be a therapeutic strategy modulating the soluble VEGI/DR3 pathway in osteosarcoma patients. PMID: 25778932
  29. Subjects with the TNFSF15 -358CC genotype have a higher risk of developing gastric adenocarcinoma in the Helicobacter pylori-infected group. PMID: 25251497
  30. TL1A may contribute to inflammatory bowel disease pathogenesis via local, but not systemic, induction of IL-17A, but not IL-4, IL-13, or IFN-γ. PMID: 26072972
  31. Elevated serum and synovial fluid levels of TL1A and DcR3 are observed in rheumatoid arthritis (RA) patients, suggesting their contribution to RA pathogenesis. PMID: 25647275
  32. TNFSF15 SNPs (rs6478108 and rs4574921) may be independent genetic predictors for stricture/non-perianal penetrating complications and perianal fistula, respectively. PMID: 24835165
  33. TL1A increases the expression of CD25, LFA-1, CD134, and CD154 and induces IL-22 and GM-CSF production from effector CD4 T-cells. PMID: 25148371
  34. TL1A augments group 3 innate lymphoid cell (ILC3) proliferation in combination with IL-1β and IL-23. PMID: 26046454
  35. An association exists between TNFSF15-rs3810936 and autoimmune uveitis (AAU), suggesting the involvement of the TL1A/DR3 pathway in AAU pathogenesis. PMID: 26200500
  36. Associations exist between TNFSF15 gene polymorphisms and inflammatory bowel disease (both Crohn's disease and ulcerative colitis) in the Indian population. PMID: 25501099
  37. TL1A promotes Th17 differentiation in rheumatoid arthritis via RORc activation, potentially mediated by TL1A binding with DR3. PMID: 24832108
  38. Elevated TL1A blood levels and higher TL1A expression in psoriatic lesions compared to normal skin are observed in psoriasis patients. PMID: 25908025
  39. The human primary biliary cirrhosis-susceptible allele of rs4979462 enhances TNFSF15 expression by binding NF-1. PMID: 25899471
  40. Soluble TL1A synergizes with IL-23 to stimulate IL-17 production from peripheral blood mononuclear cells in psoriasis vulgaris patients. PMID: 25200589
  41. This meta-analysis indicates that most of the seven TNFSF15 polymorphisms (except for rs4263839) are risk factors for Crohn's disease and ulcerative colitis susceptibility. Ethnicity did not significantly influence the risk. PMID: 25028192
  42. DR3 is expressed in some interstitial vascular endothelial cells (EC) in human kidney in situ; these EC also respond to its ligand TL1A by activating NF-κB. PMID: 25399326
  43. Mechanisms mediating TNFSF15:DR3 contributions to pattern recognition receptor outcomes include TACE-induced TNFSF15 cleavage to soluble TNFSF15; soluble TNFSF15 then leads to TRADD/FADD/MALT-1- and caspase-8-mediated autocrine IL-1 secretion. PMID: 25197060
  44. This is the first report of an association between early Crohn's disease and TNFSF15 single nucleotide polymorphisms. PMID: 25664710
  45. Tumor-infiltrating natural killer and CD4(+) T cells, under the influence of cancer cells, significantly increase IFN-γ production, which inhibits TNFSF15 expression in vascular endothelial cells. PMID: 24141405
  46. TNFSF15 may play an important role in primary biliary cirrhosis pathogenesis. PMID: 24016146
  47. TL1A plays a key role in promoting group 2 innate lymphoid cells (ILC2s) at mucosal barriers. PMID: 24220298
  48. Combining the TNFSF15 genetic marker with anti-Saccharomyces cerevisiae antibodies (ASCA) IgA improved the prediction of stenosis/perforating phenotype in Crohn's disease patients with TNFSF15, but not with a NOD2 genetic background. PMID: 24783249
  49. A TNFSF15 genetic polymorphism is associated with psoriasis and psoriatic arthritis in Hungarians. PMID: 24269700
  50. Attenuated Salmonella typhimurium carrying the dual-function plasmid VEGI151/survivin can be specifically enriched in tumor tissue and exhibits a synergistic antitumor effect in vivo. PMID: 23404494
Database Links

HGNC: 11931

OMIM: 604052

KEGG: hsa:9966

STRING: 9606.ENSP00000363157

UniGene: Hs.23349

Protein Families
Tumor necrosis factor family
Subcellular Location
Membrane; Single-pass type II membrane protein.; [Tumor necrosis factor ligand superfamily member 15, secreted form]: Secreted.
Tissue Specificity
Specifically expressed in endothelial cells. Detected in monocytes, placenta, lung, liver, kidney, skeletal muscle, pancreas, spleen, prostate, small intestine and colon.

Q&A

What is TNFSF15 and what are its primary biological functions?

Tumor necrosis factor ligand superfamily member 15 (TNFSF15) is a cytokine of the TNF superfamily that plays crucial roles in vascular homeostasis and inflammatory regulation. This protein primarily functions through binding to death receptor 3 (TNFRSF25), which initiates signaling cascades that promote T-cell activation, proliferation, and generation of multiple cytokines . The TNFSF15-TNFRSF25 signaling axis is essential for effective T-cell immune responses, particularly in T-cell-mediated autoimmune diseases .

Methodologically, when studying TNFSF15's basic functions, researchers should consider both membrane-bound and soluble forms of the protein, as TNFSF15 can be cleaved by TNF converting enzyme (TACE) to produce the soluble form that maintains biological activity . This distinction is important for experimental design, as the different forms may have distinct biological effects depending on the cellular context.

How does TNFSF15 interact with pattern-recognition receptors in immune responses?

TNFSF15 significantly amplifies cytokine responses initiated by multiple pattern-recognition receptors (PRRs), including NOD2 and various Toll-like receptors (TLRs). TNFSF15:DR3 interactions have been demonstrated to dramatically enhance PRR-induced cytokine production in human monocyte-derived macrophages (MDM) and monocyte-derived dendritic cells (MDDC) .

When designing experiments to study these interactions, it's important to note that knockdown of either TNFSF15 or DR3 results in reduced NOD2-induced cytokine secretion, including both pro-inflammatory and anti-inflammatory cytokines . The experimental approach typically involves:

  • siRNA-mediated knockdown of TNFSF15 or DR3

  • Antibody-mediated neutralization of the receptor-ligand interaction

  • Stimulation with PRR ligands such as muramyl dipeptide (MDP, for NOD2)

  • Measurement of cytokine production using ELISA or multiplex assays

Researchers should consider that these amplification effects extend beyond standard PRR ligands to include responses to mycobacterial components and live bacteria, particularly relevant in intestinal myeloid cells .

What expression patterns of TNFSF15 and DR3 are observed in human immune cells?

DR3 is expressed at detectable levels on human monocyte-derived macrophages (MDM), though at lower levels than on activated T cells . Surface expression of DR3 on MDM remains relatively stable following pattern-recognition receptor stimulation.

In contrast, TNFSF15 expression on the surface of MDM increases following NOD2 stimulation, with peak expression occurring 12-24 hours after treatment with MDP (typically dosed at 100 μg/mL in experimental settings) . This temporal pattern is important for experimental design when studying TNFSF15-DR3 interactions in MDM.

For accurate assessment of TNFSF15 and DR3 expression:

  • Use flow cytometry with validated antibodies (confirm specificity through positive controls such as activated T cells for DR3)

  • Include siRNA knockdown controls to verify antibody specificity

  • Examine both surface and intracellular expression

  • Consider time-course experiments to capture dynamic changes in expression following stimulation

How do genetic variants in the TNFSF15 gene region influence disease susceptibility and progression?

TNFSF15 gene variants have been associated with multiple immune-mediated diseases, including inflammatory bowel disease (IBD) and leprosy. Among the disease-associated polymorphisms, rs6478108 and rs4979462 have shown significant impacts on immune function and disease outcomes.

The rs4979462 polymorphism specifically:

  • Shows increased frequency of combined genotypes (CT + TT) and T-allele among female SLE patients compared to healthy controls (OR = 2.6, 95% CI = 1.1–6.3, p = 0.027; OR = 2.7, 95% CI = 1.2–6.3, p = 0.015, respectively)

  • Is significantly associated with serositis and thrombotic manifestations in SLE patients (OR = 2.8, 95% CI = 1.1–7.1, p = 0.032; OR = 2.9, 95% CI = 1.1–7.8, p = 0.023, respectively)

The rs6478108 polymorphism:

  • Modulates NOD2-induced IL-1β secretion in monocyte-derived macrophages, with A risk allele carriers showing enhanced cytokine production

  • Affects cytokine responses to multiple TLR stimuli alone or in combination with NOD2 activation

  • Represents a gain-of-function variant, with MDM from A risk carriers showing increased TNFSF15 expression and enhanced NOD2-induced signaling

When investigating TNFSF15 genetic variants, researchers should:

  • Genotype subjects using polymerase chain reaction-restriction fragment length polymorphism and verify through direct sequencing

  • Include appropriate age- and sex-matched controls

  • Correlate genotypes with functional outcomes (cytokine production, signaling pathway activation)

  • Consider the potential interaction between multiple genetic variants

What signaling mechanisms mediate TNFSF15-induced amplification of cytokine responses?

TNFSF15 amplifies PRR-induced cytokine secretion through complex signaling pathways. Critical mechanistic insights for researchers include:

  • The directionality of signaling is from TNFSF15 to DR3, not vice versa. Experiments with recombinant DR3 fail to enhance MDP-induced cytokines, while soluble TNFSF15 successfully amplifies these responses .

  • TNFSF15:DR3 signaling promotes activation of multiple pathways:

    • MAPK, NF-κB, and PI3K pathways following NOD2 stimulation

    • TRADD/FADD/MALT1 complexes

    • Caspase-8-dependent, but caspase-1-independent, IL-1 secretion

  • The soluble form of TNFSF15 (cleaved by TACE) is sufficient for cytokine amplification in MDM .

When designing experiments to investigate these signaling mechanisms, researchers should:

  • Use multiple approaches to block or enhance signaling (siRNA knockdown, pharmacological inhibitors, neutralizing antibodies)

  • Examine early signaling events (within 15 minutes of stimulation) to capture initial pathway activation

  • Include appropriate controls for pathway selectivity and cell viability

  • Consider the temporal dynamics of membrane-bound versus soluble TNFSF15

What methodological approaches are effective for studying TNFSF15 in experimental systems?

When working with TNFSF15 in research settings, several methodological considerations optimize experimental outcomes:

For protein detection and quantification:

  • Enzyme-linked immunosorbent assay (ELISA) for measuring TNFSF15 serum levels

  • Flow cytometry for surface and intracellular expression analysis

  • Western blotting for total protein and phosphorylation status assessment

For functional studies:

  • siRNA-mediated knockdown of TNFSF15 or DR3 (verify knockdown efficiency by surface staining and/or qPCR)

  • Neutralizing antibodies for blocking TNFSF15:DR3 interactions

  • Recombinant soluble TNFSF15 protein supplementation (typically 1-100 ng/mL)

  • Suboptimal stimulation conditions (e.g., 1 μg/mL MDP) to better observe amplification effects

For genetic analyses:

  • PCR-RFLP (polymerase chain reaction-restriction fragment length polymorphism) for genotyping

  • Direct sequencing for verification

  • Larger sample sizes (100+ subjects) for sufficient statistical power when studying polymorphisms

For downstream signaling assessment:

  • Phospho-flow cytometry for single-cell signaling analysis

  • Immunoblotting for pathway component activation

  • Selective pathway inhibitors to dissect signaling requirements

How does TNFSF15 serum level correlate with disease activity in autoimmune conditions?

TNFSF15 serum levels represent a potential biomarker for disease activity in autoimmune conditions, particularly in systemic lupus erythematosus (SLE). Research findings indicate:

  • SLE patients exhibit significantly higher median serum TNFSF15 concentrations compared to healthy controls

  • TNFSF15 serum levels correlate positively with SLE disease activity (p = 0.012)

  • The elevation of TNFSF15 is consistent with its role in promoting inflammatory responses through amplification of PRR-initiated cytokine production

When designing studies to investigate TNFSF15 as a biomarker:

  • Use standardized ELISA protocols with appropriate quality controls

  • Include age- and sex-matched healthy controls

  • Correlate serum levels with validated disease activity indices

  • Consider longitudinal sampling to track changes with disease progression or treatment response

  • Account for potential confounding factors such as concurrent infections or medications

What are the optimal conditions for using recombinant TNFSF15 in experimental settings?

When working with recombinant human TNFSF15 in research applications, several technical considerations ensure optimal experimental outcomes:

Reconstitution and storage:

  • Reconstitute lyophilized protein in sterile buffer (typically PBS or water)

  • Prepare small aliquots to avoid freeze-thaw cycles

  • Store at -80°C for long-term or -20°C for short-term use

  • Avoid repeated freeze-thaw cycles which can reduce biological activity

Concentration range:

  • For cell stimulation experiments: typically 1-100 ng/mL

  • For amplifying PRR responses: 10-50 ng/mL is often effective

  • Perform dose-response curves for each cell type and experimental system

Timing considerations:

  • Pre-treatment (1-2 hours) with TNFSF15 before PRR stimulation can enhance responses

  • Alternatively, co-stimulation with PRR ligands can be effective

  • For observing amplification of early signaling events, simultaneous addition is preferred

Quality control:

  • Verify protein activity using known responsive cell types (e.g., MDM)

  • Include positive controls (e.g., LPS-induced cytokine production)

  • Test for endotoxin contamination, particularly important when studying inflammatory responses

How can inconsistent results with TNFSF15 in different cell types be reconciled?

Variability in TNFSF15 responses across different cell types is common and may reflect biological realities rather than technical errors. To address this challenge:

  • Verify DR3 expression on target cells, as receptor levels significantly influence responsiveness

  • Consider the differentiation state of myeloid cells, as this affects both TNFSF15 and DR3 expression

  • Account for donor variability by increasing sample size or using cells from the same donor for comparative experiments

  • Examine potential co-receptor expression that might modulate TNFSF15:DR3 signaling

  • Test both membrane-bound and soluble forms of TNFSF15, as their effects may differ between cell types

It's worth noting that while TNFSF15 amplifies cytokine secretion in response to multiple PRR stimuli in monocyte-derived cells, its effects on dectin ligand-induced anti-inflammatory cytokine secretion are minimal , indicating pathway selectivity that should be considered when interpreting experimental results.

What controls are essential when evaluating TNFSF15 genetic variant effects?

When studying the functional consequences of TNFSF15 genetic variants:

  • Include multiple polymorphisms in the TNFSF15 region rather than focusing on a single variant

  • Verify genotyping results using secondary methods (e.g., direct sequencing after PCR-RFLP)

  • Include cell viability assessments to ensure observed effects aren't due to differential cell survival

  • Test pathway selectivity by examining responses to various stimuli

  • Control for population stratification in genetic association studies

  • Consider gene-gene interactions, particularly with other immune-related risk loci

The rs6478108 polymorphism has been established as functionally significant through studies of 100+ healthy individuals, demonstrating its effect on NOD2-induced IL-1β secretion . This level of validation should be the standard when evaluating other TNFSF15 variants.

What are the promising therapeutic applications targeting the TNFSF15-DR3 pathway?

The TNFSF15:DR3 signaling axis represents a potential therapeutic target for inflammatory and autoimmune diseases. Current evidence suggests several promising approaches:

  • Blocking TNFSF15:DR3 interactions could attenuate excessive inflammation in conditions like IBD, where TNFSF15 risk polymorphisms are gain-of-function variants

  • Targeting TACE-mediated processing of TNFSF15 might provide a more selective approach than complete pathway blockade

  • Pathway-specific inhibition of downstream signaling components (TRADD/FADD/MALT1 or caspase-8) could modulate specific outcomes while preserving others

  • Monitoring TNFSF15 serum levels could serve as a biomarker for disease activity and treatment response in SLE and potentially other autoimmune conditions

Future research should focus on:

  • Developing selective inhibitors of TNFSF15:DR3 interactions

  • Exploring tissue-specific modulation of this pathway

  • Investigating combination approaches targeting multiple inflammatory pathways

  • Conducting larger longitudinal studies to validate TNFSF15 as a biomarker

How might TNFSF15 research inform our understanding of innate-adaptive immune crosstalk?

TNFSF15 occupies a unique position at the interface between innate and adaptive immunity:

  • It enhances PRR-initiated innate immune responses in myeloid cells

  • It promotes T-cell activation and proliferation

  • It regulates cytokine networks that bridge innate and adaptive responses

This dual functionality positions TNFSF15 as an important mediator of immune crosstalk. Future research directions should explore:

  • The impact of TNFSF15-amplified innate responses on subsequent adaptive immunity

  • Temporal dynamics of TNFSF15 expression during evolving immune responses

  • Cell-specific roles of TNFSF15 in different tissue microenvironments

  • The contribution of TNFSF15 genetic variants to the balance between innate and adaptive immunity in various disease states

By understanding these relationships, researchers may develop more targeted approaches to modulate specific aspects of immunity while preserving beneficial immune functions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.