Recombinant Human Tumor necrosis factor receptor superfamily member 5 (CD40)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery time information.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice shipping is required, please inform us beforehand. Additional fees may apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage condition, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
CD40; TNFRSF5; Tumor necrosis factor receptor superfamily member 5; B-cell surface antigen CD40; Bp50; CD40L receptor; CDw40; CD antigen CD40
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-277
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Uniprot No.

Target Background

Function
CD40 is a receptor for TNFSF5/CD40LG. It transduces TRAF6- and MAP3K8-mediated signals that activate ERK in macrophages and B cells, ultimately leading to the induction of immunoglobulin secretion.
Gene References Into Functions
  1. CD40 plays a critical role in the upregulation of HIF-1alpha and PTEN, contributing to the severity of microangiopathy. PMID: 29549140
  2. The CD40 rs1883832 T allele is associated with increased susceptibility to sepsis. It may contribute to sepsis by influencing CD40 expression and plasma sCD40L levels. PMID: 29780830
  3. While the 3'-UTR CD40LG (CA)n microsatellite is not a genetic marker for rheumatoid arthritis in the western Mexican population, research suggests its role in CD40LG mRNA expression. PMID: 28963582
  4. LOAd703, a designed adenovirus armed with trimerized CD40L and 4-1BBL, activates the CD40 and 4-1BB pathways respectively. PMID: 28536305
  5. Inducible activation of MyD88 and CD40 in CAR T cells using a small-molecule drug not only enhances their effector function, leading to potent antitumor activity in preclinical solid tumors, but also enables their remote control post-infusion. PMID: 28801306
  6. The rs3765459 variant in the CD40 gene is associated with susceptibility to neuromyelitis optica spectrum disorders. PMID: 27578014
  7. Our research revealed an association of different CD40 SNPs with Graves disease and Hashimoto's Thyroiditis susceptibility in Chinese patients. This suggests the presence of multiple susceptibility loci within CD40, each contributing distinct effects in the onset and development of autoimmune thyroid diseases. PMID: 28742400
  8. CD40 gene rs4810485 and rs1883832 mutations were investigated in patients with Recurrent aphthous stomatitis. PMID: 27875792
  9. These data demonstrated that miR-145-5p may function as a cardiac-protective molecule in myocardial ischemic injury by ameliorating inflammation and apoptosis via negative regulation of CD40. PMID: 28281187
  10. rs4810485 G>T and rs1883832 C >T SNPs in the CD40 gene may be associated with disease susceptibility and severity in knee osteoarthritis in the Chinese Han population. PMID: 28320398
  11. miR-145 is involved in the anti-proliferation and anti-inflammatory effects of aspirin on vascular smooth muscle cells by inhibiting the expression of CD40. PMID: 27412561
  12. Selective knockdown of TNFR5 mitigates glucolipotoxic induction of STAT1 expression and NF-kappaB activity. PMID: 27512950
  13. CD40 signaling in adipose tissue macrophages regulates major histocompatibility complex class II and CD86 expression to control the expansion of CD4(+) T cells. PMID: 26658005
  14. CD40 activation resulted in the down-regulation of Thioredoxin (Trx)-1, enabling ASK1 activation and apoptosis. While soluble receptor agonist alone did not induce death, combinatorial treatment incorporating soluble CD40 agonist and pharmacological inhibition of Trx-1 was functionally equivalent to the signal triggered by mCD40L. PMID: 27869172
  15. Autologous CD4(+) T cells exposed to EVs from CD40/IL-4-stimulated CLL cells exhibit enhanced migration, immunological synapse signaling, and interactions with tumor cells. PMID: 27118451
  16. Cytokine expression upon simultaneous stimulation of TSHR and CD40 is greater than levels achieved with TSH or CD40L alone. Increased expression of CD40 by TSH is a potential mechanism for this process. PMID: 27631497
  17. Glatiramer acetate treatment significantly reduced CD40-mediated P65 phosphorylation in RRMS patients, suggesting that reducing CD40-mediated p-P65 induction may be a general mechanism by which some current therapies modulate Multiple Sclerosis disease. PMID: 27798157
  18. Circulating sCD40L levels are elevated in patients with cystic fibrosis and P. aeruginosa infection. PMID: 28030642
  19. Our findings support a significant association of rs4810485 in the CD40 gene and rs763361 in the CD226 gene polymorphism, with a combined effect of rs4810485 and rs763361 increasing the risk of systemic lupus erythematosus. PMID: 27722794
  20. CD40 activity in thyrocytes is predominantly mediated via NF-kappaB. PMID: 27929668
  21. Polymorphisms in the TP63 and CD40 genes are associated with lung cancer in a Chinese Han population. PMID: 27063419
  22. Increased CD40 ligation and reduced B-cell receptor signaling lead to higher IL-10 production in B cells from tolerant kidney transplant recipients. PMID: 27472092
  23. Essential hypertension patients exhibit increased expression of platelet CD40. PMID: 27090943
  24. CD40 monocyte is a novel inflammatory monocyte subset that could be used as a biomarker for chronic kidney disease severity. PMID: 27992360
  25. rs1535045 in the CD40 gene is likely to be associated with Coronary Artery Disease (CAD) in the Chinese Han population; rs4239702(C)-rs1535045(T) haplotype is associated with CAD. Patients with rs4239702-TT genotype exhibited higher blood lipid levels compared to others. PMID: 27200368
  26. These findings suggest that the CD40 SNPs rs1883832 and rs4810485 are not RA susceptibility markers in the western Mexican population. Further research is needed to clarify their roles in CD40 mRNA expression. PMID: 27813548
  27. Functional expression of CD40 on tumor cells might play a significant role in tumor progression and lymph node metastasis in esophageal squamous cell carcinoma. PMID: 27630283
  28. It is probable that CD40/CD40L interactions and TNF alpha are effective against cervical carcinomas by repressing the transcriptional activity of the human papilloma virus-18 promoter. PMID: 27031714
  29. We demonstrate that antigen targeting to CD40 can elicit potent antigen-specific CD8(+) T cell responses in human CD40 transgenic mice. PMID: 27077111
  30. Our findings indicate that the CD40 -1C/T SNP (rs1883832) is correlated with the susceptibility to lung cancer in the Chinese population. Furthermore, the TT genotype may further elevate the risk of lung cancer. PMID: 26823861
  31. The CD40/CD40L system plays a role in regulating bone mineral density. PMID: 26545336
  32. Significant differences were observed in the gene and allele frequencies of CD40 gene rs1883832 C/T polymorphism between patients with systemic lupus erythematosus and controls. sCD40 levels were elevated in SLE patients compared to controls. PMID: 26289938
  33. This study provides preliminary evidence suggesting that CD40 may stimulate tumor growth by enabling immune evasion via MDSC recruitment and inhibition of T cell expansion. PMID: 26462153
  34. Our findings highlight new roles for CD40 and cysteine-238-mediated CD40 homodimers in cell biology and identify a potential new target for therapeutic strategies against CD40-associated chronic inflammatory diseases. PMID: 25977307
  35. Meta-analyses confirm that the CD40 rs4810485 G/T polymorphism is associated with susceptibility to rheumatoid arthritis and systemic lupus erythematosus in Europeans. PMID: 25908480
  36. Platelet CD40 plays a crucial role in inflammation by stimulating leukocyte activation and recruitment and activation of endothelial cells, thereby promoting atherosclerosis. PMID: 26821950
  37. The CD40 gene may play a role in the development of systemic lupus erythematosus in the Chinese population. PMID: 26474561
  38. Studies suggest that the CD40 antigen/CD154 antigen pathway represents a promising potential therapeutic target for the prevention of transplantation rejection. PMID: 26268734
  39. This study shows a multiple sclerosis(MS)risk genotype-dependent reduction of CD40 cell-surface protein in B-lymphocytes and polarised dendritic cells; MS patients, regardless of genotype, express lower levels of CD40 cell-surface protein compared to controls in B lymphocytes; both genotype-dependent and independent downregulation of cell-surface CD40 is a feature of MS. PMID: 26068105
  40. The ability of IL21 to modulate gene and miRNA expressions in CD40-activated Chronic Lymphocytic Leukemiacells was investigated. PMID: 26305332
  41. The direct CD40-CD40L interaction of breast tumor cells and activated T cells increases TGF-beta production and the differentiation of Th17 cells, which promotes the proliferation of breast cancer cells. PMID: 25992978
  42. Differences in the expression levels of CD40 due to different genotypes of these two SNPs (rs4810485 and rs1883832) may contribute to the development of skin lesions or genital ulcers in patients with Behcet disease. PMID: 25373542
  43. CD40 rs1883832C>T SNP decreases gene CD40 expression. PMID: 25600834
  44. The presence of CD40 on the T cell membrane is crucial for the induction of recombinase activity in patients with autoimmune type 1 diabetes mellitus. PMID: 22803080
  45. CD40 expression is significantly correlated with the TNM stage and the presence of distant metastasis in gastric carcinoma patients. PMID: 25665853
  46. CD40 signaling led to sustained ERK1/2 activation and up-regulation of Bcl-xL in BCR-primed HF1A3 germinal center B cells. PMID: 26054744
  47. Subjects with the chronic hepatitis B (CHB) risk genotype TT of rs1883832 had the lowest plasma concentration of CD40, followed by subjects with CT and CC genotypes in both healthy controls and CHB patients. PMID: 25802187
  48. On the surface of B lymphocytes, the CD40 expression levels in individuals with the TT genotype were significantly lower than those with CC and CT genotypes in either ASC group or healthy controls. PMID: 25547203
  49. A possible additive combined effect between CD40-1C>T and CTLA4+6230G>A polymorphisms in the development of Graves' disease. PMID: 25936345
  50. There is a lack of association between CD40 polymorphisms and acute rejection in German liver transplant recipients. PMID: 25305459

Show More

Hide All

Database Links

HGNC: 11919

OMIM: 109535

KEGG: hsa:958

STRING: 9606.ENSP00000361359

UniGene: Hs.472860

Involvement In Disease
Immunodeficiency with hyper-IgM 3 (HIGM3)
Subcellular Location
[Isoform I]: Cell membrane; Single-pass type I membrane protein.; [Isoform II]: Secreted.
Tissue Specificity
B-cells and in primary carcinomas.

Q&A

What is CD40 and what structural characteristics define it?

CD40, also known as TNFRSF5, is a 45-50 kDa type I transmembrane glycoprotein belonging to the TNF receptor superfamily. The mature human CD40 consists of a 173 amino acid extracellular domain, a transmembrane domain, and a 62 amino acid cytoplasmic domain . The extracellular domain of human CD40 shares 58% and 56% amino acid sequence identity with mouse and rat CD40, respectively. It's important to note that an antagonistic soluble human CD40 splice variant exists, containing an alternate sequence within the extracellular and transmembrane domains and lacking a cytoplasmic domain . This structural variation has significant implications for experimental design when using recombinant CD40 proteins.

Where is CD40 expressed in normal human tissues?

CD40 expression occurs across multiple cell types with varying functional significance. It is expressed on the surface of B cells, dendritic cells, macrophages, monocytes, and platelets, as well as on endothelial and epithelial cells . When designing experiments to study CD40 function, researchers should account for this diverse expression pattern, particularly when using co-culture systems or investigating tissue-specific effects. Expression levels can vary significantly based on cell activation state and microenvironment factors, requiring careful experimental controls when studying CD40 in different cellular contexts.

What is the primary signaling mechanism of CD40?

CD40 signaling is initiated through interaction with CD40 Ligand (CD40L), leading to aggregation of CD40 molecules. This aggregation triggers bidirectional intracellular signaling cascades in both CD40 and CD40L-expressing cells . Methodologically, when investigating CD40 signaling, researchers should consider:

  • The activation of NF-κB is a primary downstream effect of CD40 stimulation

  • CD40 signaling activates STAT family members, particularly STAT3 and STAT6

  • Expression analysis should include assessment of known NF-κB target genes to confirm successful CD40 activation

  • Time-course experiments are essential as CD40 signaling induces time-dependent regulation of multiple transcription factors

How should CD40 signaling be monitored in experimental settings?

CD40 signaling can be monitored through several complementary approaches:

  • Gene expression analysis focusing on the CD40 signature genes identified through microarray studies

  • Assessment of NF-κB activation via immunoblotting or immunohistochemical analysis

  • Evaluation of IκB alpha and IκB epsilon expression, which are upregulated as part of the CD40 signaling cascade

  • Monitoring changes in expression of GC B-cell markers like CD38, BCL-6, and OCA-B, which are typically downregulated upon CD40 stimulation

When designing such experiments, include appropriate time points (4-24 hours post-stimulation) to capture both early and late response genes.

How does CD40 signaling differ across B-cell developmental stages?

CD40 signaling demonstrates stage-specific activity during B-cell development, particularly in germinal center (GC) reactions. Research indicates the absence of CD40 signaling in centroblasts (CBs) and in most centrocytes (CCs), while suggesting activity in pre- and post-GC B cells .

To investigate stage-specific CD40 activity, researchers should:

  • Isolate distinct B-cell populations using specific markers (e.g., CD77+/CD38high for centroblasts; CD10+/CD38high/CD77- for centrocytes; CD27+/CD38low/CD10- for memory B cells)

  • Perform gene expression profiling focusing on the CD40 signature genes

  • Utilize both discrete and continuous binary scoring approaches to quantify the relatedness of individual subpopulation pairs to the CD40 signature

  • Validate findings through immunohistochemical analysis of NF-κB activation and CD40-induced gene expression

Binary scoring analyses have demonstrated the presence of the CD40 signature in memory and naive B cells at high significance (P ≤ 10-7) when compared with GC B cells, suggesting differential activation patterns requiring careful experimental design .

What methodological approaches are recommended for studying CD40's role in cancer immunotherapy?

CD40 serves multiple functions in both hematopoietic and epithelial cancers and represents a target for tumor immunotherapy . When investigating CD40's role in cancer contexts, researchers should:

  • Establish whether the tumor model expresses CD40 directly or if effects are mediated through immune cell activation

  • Design experiments that distinguish between direct tumor cell effects and indirect immune-mediated effects

  • Consider combinatorial approaches with other immune checkpoint modulators

  • Implement spatial transcriptomics or single-cell analysis to map CD40 signaling within the tumor microenvironment

  • Account for potential differences between human and mouse CD40 biology when translating preclinical findings

Given the bidirectional signaling properties of CD40-CD40L interactions, researchers should design controls that distinguish between effects on CD40-expressing cells versus CD40L-expressing cells within the tumor microenvironment.

What are the methodological considerations when using Mendelian randomization to study CD40's causal role in disease?

Mendelian randomization (MR) represents a valuable approach for exploring causal relationships between CD40 and disease outcomes. When implementing MR studies for CD40, researchers should:

  • Select appropriate instrumental variables (IVs), typically single-nucleotide polymorphisms (SNPs) identified from genome-wide association studies

  • Calculate F-statistics from first-stage regression to evaluate potential weak instruments

  • Apply inverse-variance weighted (IVW) methods based on fixed-effects models when the number of IVs is limited (≤3)

  • Test for unbalanced horizontal pleiotropy using MR-Egger regression analysis

  • Perform heterogeneity testing using Cochran Q test with p-value < 0.05 indicating significant heterogeneity

  • Validate findings through leave-one-out analyses to ensure result reliability

Recent MR studies have provided evidence supporting causal associations between CD40 and reduced risks of aortic diseases, demonstrating the utility of this approach when clinical trials may be limited by safety concerns .

How should researchers address contradictory data regarding CD40's role in cardiovascular pathologies?

CD40 has been implicated in multiple cardiovascular diseases including atherosclerosis, atherothrombosis, and restenosis , yet MR studies suggest protective effects against aortic dissection and aneurysm . To address these contradictions, researchers should:

  • Distinguish between acute and chronic CD40 signaling effects

  • Consider tissue-specific CD40 expression and signaling patterns

  • Account for potential differences between genetic determinants of CD40 levels versus pharmacological modulation

  • Implement tissue-specific knockout or conditional expression models to isolate causal relationships

  • Design experiments that can differentiate between CD40's roles in initial pathology versus progression or resolution phases

The apparently contradictory findings highlight the complex biology of CD40 signaling and emphasize the need for comprehensive experimental approaches that address timing, context, and tissue-specificity.

What controls are essential when studying CD40 activation in vitro?

When designing experiments involving CD40 activation, researchers should implement the following controls:

  • Isotype-matched control antibodies when using anti-CD40 agonistic antibodies

  • Heat-inactivated recombinant CD40L to control for potential contaminating factors

  • CD40-negative cell lines to confirm specificity of observed effects

  • Time-course analysis to distinguish between primary and secondary signaling events

  • Parallel assessment of multiple downstream pathways (NF-κB, STAT, MAPK) to comprehensively characterize the signaling response

Additionally, researchers should validate CD40 activation by monitoring established signature genes that change expression after CD40 activation, as identified through in vitro systems .

How should researchers account for species differences when translating CD40 findings?

The extracellular domain of human CD40 shares only moderate sequence identity with mouse (58%) and rat (56%) CD40 , which may impact cross-species translation of findings. Researchers should:

  • Validate key experiments in human primary cells or humanized models

  • Be cautious when using species-specific agonists or antagonists, as binding properties may differ

  • Compare CD40 signature gene expression patterns between species to identify conserved and divergent aspects

  • Consider species-specific differences in downstream signaling components

  • Validate therapeutic approaches in multiple model systems before clinical translation

When studying the CD40-CD40L axis in disease models, account for potential species differences in expression patterns, interaction kinetics, and downstream signaling events.

What methodological approaches can distinguish between different forms of CD40?

Researchers must distinguish between membrane-bound CD40 and soluble CD40 variants, which may have different or even opposing functions. Recommended approaches include:

  • Western blotting with antibodies specific to different domains to differentiate full-length and truncated forms

  • RT-PCR with primers designed to detect specific splice variants

  • Flow cytometry using antibodies targeting different epitopes of CD40

  • Functional assays comparing responses to soluble versus membrane-bound CD40L

  • Mass spectrometry to identify post-translational modifications that may affect function

The antagonistic soluble human CD40 splice variant contains an alternate sequence within the extracellular and transmembrane domains and lacks a cytoplasmic domain, potentially competing with membrane-bound CD40 for ligand binding .

What safety concerns should researchers address when targeting CD40/CD40L in experimental models?

When designing experiments targeting the CD40/CD40L pathway, researchers should consider several safety concerns:

  • Immunosuppression effects from CD40/CD40L blockade may increase risks of infection and cancer in long-term studies

  • Thromboembolic events have been reported in anti-CD40L pre-clinical and clinical trials, indicating CD40L's role in thrombus stabilization

  • High incidence of thromboembolic complications was observed in monkeys treated with anti-CD40L antibodies

  • Large thrombi in CD40L-deficient mice were prone to rupture and embolization

  • A clinical trial of anti-CD40L antibody in patients with lupus glomerulonephritis was terminated due to thromboembolic events

These safety considerations should inform experimental design, particularly for in vivo studies and when planning potential translational applications.

How can researchers investigate CD40's dual roles in disease pathogenesis?

CD40 exhibits context-dependent functions that may be protective or pathogenic depending on the disease setting. To investigate these dual roles, researchers should:

  • Design time-course experiments to capture both acute and chronic effects of CD40 modulation

  • Implement cell-specific or inducible knockout/overexpression systems to isolate CD40 functions in specific cell types

  • Consider the local microenvironment when interpreting CD40 signaling effects

  • Analyze both direct CD40 signaling and indirect effects mediated through altered cell-cell interactions

  • Utilize systems biology approaches to model CD40 network effects in different disease contexts

These methodological approaches can help reconcile apparently contradictory findings, such as CD40's proposed pro-inflammatory role in atherosclerosis versus its protective effect against aortic disease suggested by MR studies .

What emerging technologies are advancing CD40 research?

Several cutting-edge technologies are enhancing our understanding of CD40 biology:

  • Single-cell RNA sequencing to map CD40 expression and response patterns at unprecedented resolution

  • CRISPR-Cas9 genome editing for precise manipulation of CD40 pathway components

  • Optogenetic approaches to achieve temporal control of CD40 signaling

  • Spatial transcriptomics to understand CD40 signaling in tissue microenvironments

  • Advanced protein engineering to develop highly specific CD40 pathway modulators with improved safety profiles

These technologies are helping resolve longstanding questions about the context-specific functions of CD40 in health and disease.

What are priority research areas for CD40 in the next five years?

Based on current knowledge gaps and technological capabilities, priority research areas include:

  • Elucidating the mechanisms underlying the protective effect of CD40 against aortic diseases while potentially promoting other cardiovascular pathologies

  • Developing safer therapeutic approaches targeting CD40/CD40L that avoid thromboembolic complications

  • Understanding how CD40 signaling integrates with other immune pathways in complex disease settings

  • Identifying biomarkers that predict response to CD40-targeted therapies

  • Exploring the potential of cell-specific CD40 modulation as a therapeutic strategy

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.