Recombinant Human Tumor necrosis factor receptor superfamily member 8 (TNFRSF8)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Isoforms

TNFRSF8 is a 120 kDa type I transmembrane glycoprotein comprising:

  • Extracellular domain (ECD): 361 amino acids (aa) with six cysteine-rich repeats (Phe19-Lys379)

  • Transmembrane domain: 28 aa

  • Cytoplasmic domain: 188 aa, containing TRAF-binding motifs for NF-κB activation

Alternative splicing generates a truncated isoform with only 132 aa in the cytoplasmic domain . Species-specific variations exist, with human CD30 sharing 53% and 49% aa identity with mouse and rat homologs, respectively .

Functional Properties

  • Ligand Binding: Binds CD30 Ligand (TNFSF8/CD153) with high affinity, confirmed via surface plasmon resonance and ELISA (EC₅₀ = 9.53–20.25 ng/mL) .

  • Signaling Pathways:

    • Activates NF-κB and JNK via TRAF2/5 recruitment, promoting lymphocyte proliferation and cytokine secretion (e.g., IL-13) .

    • Induces apoptosis in CD4+CD8+ thymocytes through caspase activation .

  • Soluble Form: An 85–90 kDa fragment shed by TACE cleavage acts as a decoy receptor, inhibiting membrane-bound CD30 signaling .

Research Applications

Recombinant TNFRSF8 is utilized in:

  1. Immune Cell Studies:

    • T/B cell activation assays

    • Th2 bias characterization in autoimmune models

  2. Cancer Research:

    • Biomarker detection in Hodgkin’s lymphoma (Reed-Sternberg cells) and anaplastic large-cell lymphoma

    • Target validation for antibody-drug conjugates (e.g., Brentuximab vedotin)

  3. Protein Interaction Analysis:

    • Binding kinetics with TNFSF8

    • Structural studies via SDS-PAGE (80–110 kDa under reducing conditions; 160–220 kDa non-reducing)

Clinical Relevance

  • Diagnostic Marker: Overexpressed in Hodgkin’s disease, systemic mastocytosis, and rheumatoid arthritis .

  • Therapeutic Target: Clinical trials targeting CD30 show efficacy in lymphoma regression .

  • Inflammatory Diseases: Elevated soluble CD30 correlates with disease severity in asthma and lupus .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is finalized during production. If you require a specific tag, please inform us for preferential development.
Synonyms
TNFRSF8; CD30; D1S166E; Tumor necrosis factor receptor superfamily member 8; CD30L receptor; Ki-1 antigen; Lymphocyte activation antigen CD30; CD antigen CD30
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
19-595
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLVVVVGSSAFLLCHRRACRKRIRQKLHLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYLESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK
Uniprot No.

Target Background

Function
Receptor for TNFSF8/CD30L. It plays a regulatory role in cellular growth and transformation of activated lymphoblasts, and modulates gene expression via NF-κB activation.
Gene References Into Functions

References:

  1. CD4+ T cell-associated HIV-1 RNA is often highly enriched in CD30-expressing cells, significantly contributing to the pool of transcriptionally active CD4+ lymphocytes in individuals on suppressive antiretroviral therapy. CD30 may serve as a marker for residual, transcriptionally active HIV-1 infected cells. PMID: 29470552
  2. Sustained elevated levels of sCD30 and IL6 for four or more years before Hodgkin lymphoma diagnosis may indicate a B-cell stimulatory environment conducive to cancer development. PMID: 28341757
  3. CD30, frequently expressed in extranodal NK/T-cell lymphoma, nasal type (ENKTL), represents a therapeutic target but may not be a prognostic marker. PMID: 28486951
  4. In patients with CD30+ lymphoproliferative disorders, an aggressive clinical course is not solely defined by the presence of TP63 rearrangements. PMID: 27146432
  5. Brentuximab Vedotin (SGN-35) damages CD30 ligand (CD30L)-immune cells via CD30 extracellular vesicles (EVs). PMID: 27105521
  6. The median FoxP3+ Treg count is higher in CD30+ than CD30- post-transplant lymphoproliferative disorders (3.0 vs 0). PMID: 29126177
  7. Variant histology is common in pediatric NLPHL, particularly types C and E, associated with IgD expression. Type C and possibly D variants correlate with decreased event-free survival, but neither IgD nor CD30 are adverse prognostic factors. Variant histology may necessitate increased surveillance but doesn't affect overall survival. PMID: 28802087
  8. CD30 expression in DLBCL and other aggressive B-cell lymphomas, often without MYC oncogene-driven proliferation, suggests brentuximab vedotin may be an effective targeted therapy in patients with high CD30 expression. PMID: 27521276
  9. A summary of CD30 (Ki-1) antigen prevalence in human solid tumors is provided. PMID: 28427526
  10. Higher serum sCD30 levels are associated with increased risk of bacterial infection post-kidney transplantation. PMID: 28122147
  11. CD30 expression is detected in up to 25% of diffuse large B-cell lymphoma cases, more frequently in tumors without MYC rearrangement. CD30 expression was not associated with overall survival in R-EPOCH-treated de novo DLBCL patients. PMID: 27816715
  12. CD30 facilitates HSF1 phosphorylation, activates heat shock promoter elements, and induces HSP90 expression. PMID: 27870927
  13. Polyclonal and allogeneic stimulation induce higher CD30 transcript levels in end-stage renal disease patients compared to controls. PMID: 26970513
  14. CD30 expression was not associated with prognosis in de novo DLBCL patients, including those receiving aggressive chemotherapy. CD30 expression and MYC rearrangement were mutually exclusive in de novo DLBCL. PMID: 26340843
  15. A case report describes CD30-positive lymphomatoid papulosis associated with cutaneous amyloidosis in a multiple myeloma patient. PMID: 26981738
  16. Heterogeneous CD30 expression in refractory/relapsed peripheral T-cell lymphoma patients suggests a potential for better response in those with strong CD30 expression. PMID: 26703966
  17. CD30 may be a prognostic marker in R-CHOP-treated DLBCLs in Chinese populations, indicating favorable outcomes. PMID: 26884853
  18. This review focuses on CD30 and p53 as therapeutic targets in ALK+ ALCL, also updating their potential roles in ALCL pathogenesis. PMID: 26709646
  19. Angioimmunoblastic T-cell lymphoma and PTCL-NOS commonly express varying levels of CD30. PMID: 26574847
  20. Upregulated CD30 expression is frequently observed in sclerosing angiomatoid nodular transformation of the spleen. PMID: 26261484
  21. Significantly elevated sCD30 levels in ankylosing spondylitis (AS) patients compared to controls suggest a role for sCD30 in AS pathogenesis. PMID: 26273636
  22. The introduction of brentuximab vedotin highlights CD30 as a targetable molecule. This study investigated CD30 expression frequency and levels in post-transplant lymphoproliferative disorders. PMID: 25248878
  23. CD30 antigen may serve as a prognostic factor and therapeutic target in extranodal NK/T-cell lymphoma (NKTCL). PMID: 25288491
  24. CD30 antigen downregulation and P-glycoprotein (MDR1) upregulation are associated with brentuximab vedotin drug resistance. PMID: 25840583
  25. Intralymphatic ALCL and LyP may be partially explained by the lymphotropism of neoplastic cells in cutaneous CD30 lymphoproliferative disorders. PMID: 26371781
  26. BAG-3 expression correlated with increased HSP70 expression in a subset of systemic T-cell lymphomas co-expressing CD30. PMID: 24492285
  27. High sCD30 levels are independent predictors of graft dysfunction. PMID: 25698648
  28. A critical threonine residue (T61) in CD30v was identified for TRAF2 interaction, NF-κB activation, and downstream CD30-NF-κB-dependent phenotypes. PMID: 25568342
  29. A case report describes a CD30+ lymphoproliferative rash with a tendency for recurrence at the same sites. PMID: 24733405
  30. A case report details successful treatment of primary cutaneous CD30+ anaplastic large cell lymphoma with brentuximab vedotin. PMID: 24733422
  31. Elevated serum sCD30 is associated with increased non-Hodgkin lymphoma risk. PMID: 25567136
  32. A case report suggests Sezary syndrome, CD30 anaplastic large-cell lymphoma, and mycosis fungioides are interrelated. PMID: 25548993
  33. Serum sCD30 levels are higher in individuals with atopy, and improvements in lung function correlate with decreased sCD30 in children with atopy and respiratory symptoms. PMID: 25492095
  34. CD30 occurs in a significant subset of angiosarcomas and epithelioid hemangioendotheliomas. PMID: 24805132
  35. The JUNB/CD30 axis plays an oncogenic role and is a potential therapeutic target in ALK+ ALCL. PMID: 25145835
  36. A chimeric fusion involving NPM1 and TYK2 is identified in cutaneous CD30 antigen-positive lymphoproliferative disorders. PMID: 25349176
  37. CD30 expression in a substantial proportion of DLBCL suggests CD30 immunohistochemistry may be a useful prognostic marker in R-CHOP treated GCB-DLBCL. PMID: 25135752
  38. CD30 expression by mastocytosis mast cells may influence clinical phenotype and management. (Review) PMID: 24745678
  39. A significant subset of T-ALL patients have lymphoblasts expressing surface CD30, which is upregulated in patients receiving high-dose chemotherapy. PMID: 23937105
  40. Intralymphatic cutaneous anaplastic large cell lymphoma/lymphomatoid papulosis are part of an expanding spectrum of CD30-positive lymphoproliferative disorders. PMID: 24805854
  41. Higher serum levels are found in Ewing sarcoma patients with primary bone tumors. PMID: 24375064
  42. The diagnostic and prognostic value of CD30 expression in systemic mastocytosis is assessed by multiparameter flow cytometry. PMID: 24111625
  43. A novel SATB1-p21 axis plays a crucial role in the progression of cutaneous CD30+LPDs, providing molecular insights and potential therapeutic avenues. PMID: 24747435
  44. Serum sCD30 concentration during pregnancy is not associated with pre-eclampsia or recurrent pregnancy loss. PMID: 23268289
  45. CD30 expression on lymphomatous cells is a target for drug-conjugated antibody therapies. PMID: 23716537
  46. CD30(+) peripheral T-cell lymphomas differ significantly from CD30(-) samples. PMID: 23716562
  47. Post-transplant sCD30 serum levels, particularly with HLA class II antibodies and serum creatinine, provide valuable information on graft outcome. PMID: 23928467
  48. Malignant Hodgkin and Reed-Sternberg cells release CD30 on extracellular vesicles, facilitating CD30-CD30L interaction. PMID: 24659185
  49. High pre-transplant serum soluble CD30 levels are a risk factor for kidney transplant rejection; its high negative predictive value is useful for identifying low-risk candidates for acute rejection. PMID: 23477385
  50. Soluble CD30 levels are reduced with combination immunosuppression but are differentially affected by various immunosuppressants. PMID: 23503451
Database Links

HGNC: 11923

OMIM: 153243

KEGG: hsa:943

STRING: 9606.ENSP00000263932

UniGene: Hs.1314

Subcellular Location
[Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Cytoplasm.
Tissue Specificity
[Isoform 2]: Detected in alveolar macrophages (at protein level).

Q&A

What is the genomic context and basic structure of TNFRSF8?

TNFRSF8, also known as CD30 or Ki-1, is a protein-coding gene located on chromosome 1p36.22 (genomic coordinates: NC_000001.11 (12063303..12144207)). The gene encodes a member of the tumor necrosis factor receptor superfamily. Two alternatively spliced transcript variants encoding distinct isoforms have been reported . The protein is expressed on activated, but not resting, T and B cells, making it a useful marker for cell activation status in experimental models .

What are the key signaling pathways associated with TNFRSF8?

TNFRSF8 mediates signal transduction primarily through interactions with TRAF2 and TRAF5 adaptor proteins. These interactions lead to the activation of NF-kappaB signaling pathways, which regulate various cellular processes including inflammation, immune response, and cell survival . Methodologically, researchers can investigate these pathways using biochemical approaches such as co-immunoprecipitation to demonstrate protein-protein interactions, and reporter assays to quantify NF-kappaB activation in experimental settings.

What physiological functions has TNFRSF8 been demonstrated to regulate?

Research has established several key functions for TNFRSF8:

  • Positive regulation of apoptosis, suggesting its role in programmed cell death

  • Limitation of proliferative potential of autoreactive CD8 effector T cells

  • Protection against autoimmunity through immunoregulatory mechanisms

These functions highlight TNFRSF8's importance in immune homeostasis, particularly in balancing T cell responses to prevent pathological autoimmune conditions.

What methodologies are most effective for detecting TNFRSF8 expression in clinical samples?

Multiple methodologies have proven effective for TNFRSF8 detection, with distinct advantages depending on research context:

  • Immunohistochemistry (IHC): Research indicates that IHC is crucial for detecting CD30 expression in tissue samples. When examining unusual presentations such as anaplastic large cell lymphoma in the uterine cervix, CD30 staining must be performed when reniform nuclei are observed, especially when other markers like CD45 or CD3 are negative while epithelial stains (p63, EMA) are positive .

  • Flow Cytometric Immunophenotyping (FCI): This technique has been demonstrated to be a highly sensitive and specific method for identifying aberrant cells expressing TNFRSF8. In systemic mastocytosis studies, FCI has been shown to be a quick, sensitive, high-yield tool that can detect immunophenotypic aberrancy, with CD30 serving as an important marker alongside CD2 and CD25 .

  • Molecular Testing: For comprehensive characterization, researchers often complement protein expression analysis with molecular studies to identify relevant genetic alterations associated with TNFRSF8-positive conditions.

How reliable is TNFRSF8 (CD30) as a diagnostic marker in lymphoproliferative disorders?

The diagnostic value can be enhanced when CD30 is assessed alongside other markers. For instance, in cutaneous lymphomas, the biopsy findings of CD8, CD30, CD56, and TCR-γ positive atypical lymphocytic infiltration with angioinvasion and angiodestruction provided definitive diagnostic information for lymphomatoid papulosis type E .

What is the prognostic significance of TNFRSF8 expression in different lymphomas?

The prognostic value of TNFRSF8 expression varies by lymphoma type:

Lymphoma TypeTNFRSF8 Expression PatternPrognostic SignificanceReference
Extranodal NK/T-cell lymphoma (ENKTL)Positive CD30 expressionFavorable prognostic factor; can restratify survival in clinical subgroups
Tumor-stage Mycosis FungoidesCD30 positivityNo significant association with prognosis in retrospective cohort studies
Primary adrenal ALCLCD30 positiveAssociated with complete response to chemotherapy, though recurrence risk remains

These findings suggest that researchers should carefully interpret TNFRSF8 expression in a disease-specific context rather than as a universal prognostic indicator across all lymphomas.

How does TNFRSF8 contribute to lymphomagenesis and cancer progression?

While the precise mechanisms remain under investigation, research indicates that TNFRSF8 contributes to lymphomagenesis through several pathways:

  • Altered apoptotic regulation: As a positive regulator of apoptosis, dysregulation of TNFRSF8 signaling may disrupt normal cell death processes, contributing to cancer cell survival .

  • Immune evasion: TNFRSF8's role in limiting autoreactive T cell responses suggests that its aberrant expression may help cancer cells evade immune surveillance .

  • Microenvironment modulation: CD30-positive Hodgkin-Reed-Sternberg cells interact with CD4-positive T cells in the tumor microenvironment, potentially influencing immune response to tumor cells .

Researchers investigating these mechanisms methodologically employ 3D and 4D experimental systems to gain new insights into the biology of TNFRSF8-positive tumors. For example, studies have documented the duration of contacts between CD4-positive T cells and CD30-positive Hodgkin-Reed-Sternberg cells following incubation with nivolumab, providing dynamic information about immune-tumor cell interactions .

What are the mechanisms of action for TNFRSF8-targeted therapies?

TNFRSF8-targeted therapies, particularly antibody-drug conjugates like brentuximab vedotin (Adcetris), function through multiple mechanisms:

  • Targeted drug delivery: The conjugate binds to CD30 on tumor cells and delivers a cytotoxic payload (typically monomethyl auristatin E) that disrupts microtubule function, leading to cell cycle arrest and apoptosis.

  • Immunomodulatory effects: Beyond direct cytotoxicity, recent reviews suggest these therapies also affect the tumor microenvironment, potentially enhancing anti-tumor immune responses .

  • Bystander effect: Evidence indicates that TNFRSF8-targeted therapies may also affect nearby CD30-negative cells in the tumor microenvironment, expanding their efficacy beyond just the CD30-positive population .

Methodologically, researchers have reviewed substantial evidence suggesting that CD30 expression levels do not necessarily predict clinical benefit from brentuximab vedotin, as the drug has demonstrated efficacy across a wide range of CD30 expression levels .

How should clinical trials for TNFRSF8-targeting agents be designed to optimize efficacy assessment?

Based on contemporary research, optimal clinical trial design for TNFRSF8-targeting agents should incorporate:

  • Patient stratification beyond CD30 expression levels: Since clinical responses to brentuximab vedotin do not always correlate with CD30 expression levels, trials should consider additional biomarkers and disease characteristics for patient stratification .

  • Comprehensive endpoint assessment: Trials should evaluate not only traditional response rates but also durability of response, progression-free survival, and quality of life measures to fully characterize therapeutic benefit.

  • Combination strategies: Clinical trials exploring combinations with standard therapies or novel agents are abundant in the current research landscape. Examples include:

    • Brentuximab vedotin + CHP (Cyclophosphamide, Hydroxyrubicin, Prednisone) for primary cutaneous ALCL

    • Acimtamig (AFM13) in combination with allogeneic natural killer cells for relapsed/refractory CD30+ lymphomas

    • Mogamulizumab and brentuximab vedotin for CTCL and mycosis fungoides (ongoing trial with projected completion in July 2026)

    • Romidepsin and parsaclisib for relapsed/refractory T-cell lymphomas

What factors influence response to TNFRSF8-directed therapeutics beyond target expression?

Research indicates several factors beyond simple TNFRSF8 expression that may influence therapeutic response:

  • Tumor microenvironment composition: The presence and activity of immune cells in the tumor microenvironment may modulate response to TNFRSF8-targeted therapies.

  • Resistance mechanisms: Studies are investigating mechanisms of resistance to TNFRSF8-targeted therapies, with reviews focusing on "dissecting the underlying mechanisms of BV [brentuximab vedotin], discussing its effects on both tumor cells and the tumor microenvironment" .

  • Disease subtype and genetic profile: Different lymphoma subtypes with TNFRSF8 expression may respond differently to targeted therapies based on their underlying genetic and molecular features.

Methodologically, researchers are employing advanced techniques like 3D and 4D experiments in hematopathology to facilitate new insights into these factors, potentially guiding new therapeutic approaches and lymphoma classifications .

How can recombinant TNFRSF8 be utilized in experimental models of autoimmunity?

Given TNFRSF8's established role in protecting against autoimmunity by limiting autoreactive CD8 effector T cell responses , recombinant TNFRSF8 presents valuable opportunities for experimental autoimmunity research:

  • Mechanistic studies: Recombinant TNFRSF8 can be used to investigate the molecular pathways through which this receptor regulates T cell responses, providing insights into autoimmune disease pathogenesis.

  • Therapeutic potential exploration: Experimental models can test whether recombinant TNFRSF8 or mimetic molecules might serve as novel therapeutic approaches for autoimmune conditions.

  • Biomarker development: Studies can examine whether soluble forms of TNFRSF8 correlate with disease activity in experimental autoimmunity, potentially identifying new biomarkers for clinical translation.

Methodologically, researchers should employ both in vitro systems with primary immune cells and relevant in vivo models of autoimmunity, with careful attention to the timing and context of TNFRSF8 signaling.

What are the technical challenges in producing functional recombinant TNFRSF8 for research applications?

Production of functional recombinant TNFRSF8 involves several technical considerations:

  • Expression system selection: Mammalian expression systems are typically preferred to ensure proper post-translational modifications, particularly glycosylation patterns that may affect receptor function.

  • Structural integrity verification: Researchers must confirm that recombinant TNFRSF8 maintains proper folding and multimerization capacity, as TNF receptor family members often function as trimers.

  • Functional validation: Bioactivity testing should verify that recombinant TNFRSF8 can bind appropriate ligands and activate downstream signaling pathways in controlled experimental systems.

  • Stability optimization: Buffer conditions must be optimized to ensure stability during storage and experimental use without compromising biological activity.

Methodologically, researchers typically employ a combination of biochemical and cell-based assays to validate recombinant TNFRSF8, including surface plasmon resonance for binding kinetics, reporter cell lines for signaling activation, and appropriate biological response assays in primary cells.

How can contradictory findings regarding TNFRSF8 function in different experimental systems be reconciled?

Research into TNFRSF8 function has sometimes yielded seemingly contradictory results across different experimental systems. To reconcile these findings, researchers should:

  • Consider context-dependent signaling: TNFRSF8 may trigger different signaling pathways depending on cell type, activation state, and the presence of other receptors or adaptor proteins.

  • Examine species differences: Human and murine TNFRSF8 may exhibit subtle functional differences that become significant in certain experimental contexts.

  • Account for soluble versus membrane-bound forms: The soluble form of TNFRSF8, which can be generated through proteolytic cleavage or alternative splicing, may have distinct functions from the membrane-bound receptor.

  • Integrate temporal aspects: TNFRSF8 signaling effects may differ based on acute versus chronic activation, necessitating time-course studies in experimental designs.

Methodologically, researchers addressing these contradictions should employ multiple complementary techniques, include appropriate controls, and carefully document experimental conditions to facilitate reliable cross-study comparisons.

What novel therapeutic approaches targeting TNFRSF8 are currently in development?

Several innovative therapeutic approaches targeting TNFRSF8 are currently advancing through development:

  • Next-generation antibody-drug conjugates: Beyond brentuximab vedotin, newer ADCs with improved linker chemistry, novel payloads, or enhanced targeting are being evaluated.

  • Bispecific antibodies: Acimtamig (AFM13), which targets both CD30 and CD16A (FcγRIIIa), is showing promise in relapsed/refractory CD30-positive peripheral T-cell lymphomas, engaging natural killer cells against CD30-positive tumor cells .

  • Novel small molecule combinations: Trials combining targeted agents like romidepsin and parsaclisib for CD30-positive T-cell lymphomas represent attempts to enhance efficacy through complementary mechanisms of action .

  • Immunomodulatory approaches: GEN3017, currently in clinical testing for Hodgkin lymphoma and non-Hodgkin lymphoma, represents another novel approach targeting TNFRSF8-positive malignancies .

Current clinical development is reflected in multiple ongoing trials, including a first-in-human trial of GEN3017 that has progressed to the active, not recruiting phase with 240 participants .

How might single-cell technologies advance our understanding of TNFRSF8 biology in heterogeneous tissues?

Single-cell technologies offer transformative potential for TNFRSF8 research:

  • Heterogeneity characterization: Single-cell RNA sequencing can identify distinct subpopulations of TNFRSF8-expressing cells within tumors or inflammatory tissues, revealing functional diversity not apparent in bulk analyses.

  • Spatial context integration: Spatial transcriptomics and multiplexed imaging techniques can map TNFRSF8-expressing cells relative to other cell types in the tissue microenvironment, providing insights into cellular interactions and signaling networks.

  • Dynamic response profiling: Single-cell proteomics can track TNFRSF8 signaling responses at the individual cell level following therapeutic intervention, identifying responder and non-responder populations.

Methodologically, researchers are beginning to implement these technologies. The development of 3D and 4D experimental approaches in hematopathology, documenting interactions between CD30-positive Hodgkin-Reed-Sternberg cells and CD4-positive T cells, represents steps toward more sophisticated single-cell analysis of TNFRSF8 biology in complex tissues .

What is the potential role of TNFRSF8 in non-lymphoid tissues and diseases?

While TNFRSF8 is primarily studied in lymphoid contexts, emerging research suggests broader relevance:

  • Mast cell biology: Studies have identified CD30 as an important marker for detecting immunophenotypic aberrancy in mast cells in systemic mastocytosis, alongside CD2 and CD25. Flow cytometric immunophenotyping revealing abnormal expression should prompt careful histologic evaluation and KIT D816V mutation testing .

  • Autoimmune conditions: The known role of TNFRSF8 in limiting autoreactive T cells suggests potential involvement in various autoimmune diseases beyond classical lymphoproliferative disorders .

  • Fibrotic disorders: Clinical trials of brentuximab vedotin in early diffuse cutaneous systemic sclerosis (dcSSc) suggest potential applications in fibrotic conditions, with a phase 2 open-label extension study currently recruiting with expected completion in July 2026 .

Methodologically, researchers investigating these non-lymphoid applications should employ comprehensive tissue profiling, functional studies in relevant cell types, and careful correlation of TNFRSF8 expression with clinical parameters in patient cohorts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.