Recombinant Human Tumor suppressor candidate 3 (TUSC3)

Shipped with Ice Packs
In Stock

Description

Tumor Suppression Mechanisms

TUSC3 acts as a tumor suppressor by:

  • Inhibiting metastasis: TUSC3 deficiency enhances ATF6α-dependent unfolded protein response (UPR) and HRD1-mediated ER-associated degradation (ERAD), promoting metastasis in non-small cell lung cancer (NSCLC) .

  • Regulating p53 stability: TUSC3 binds HRD1, reducing ubiquitination of p53 and NM23H1/2, which suppresses metastasis .

  • Modulating ER stress: TUSC3 loss disrupts glycosylation, exacerbating ER stress and driving malignant transformation .

Cancer TypeTUSC3 ExpressionClinical Implication
NSCLC DownregulatedEnhanced metastasis
Ovarian cancer DownregulatedPromotes proliferation/migration
Prostate cancer DownregulatedAlleviates ER stress

Role in ER Stress and Glycosylation

TUSC3 influences ER stress pathways through:

  • UPR modulation: TUSC3 deficiency selectively activates ATF6α, while suppressing IRE1α and PERK pathways .

  • Glycosylation efficiency: TUSC3 enhances N-linked glycosylation of integrins and lectins, critical for cell adhesion and metastasis .

In Vitro and In Vivo Studies

Study TypeKey FindingsSource
Orthotopic xenograftsTUSC3 knockdown (KD) in H460 NSCLC cells increased lung metastasis nodules .
miRNA regulationmiR-224/-520c inhibit TUSC3, correlating with metastasis in lung cancer patients .
p53 interactionTUSC3 overexpression reduces polyubiquitinated p53, preventing degradation .

Mechanistic Insights

  • ERAD regulation: TUSC3 competes with HRD1 for binding to PERK, IRE1α, and p53, stabilizing these proteins .

  • Glycome alterations: TUSC3 deficiency disrupts protein glycosylation, inducing ER stress and metastatic phenotypes .

Recombinant TUSC3 in Research

Recombinant TUSC3 is used to:

  • Restore glycosylation: In cell models with TUSC3 deficiency, recombinant protein rescues N-linked glycosylation defects .

  • Study ER stress: Overexpression in cancer cells modulates UPR pathways and metastatic potential .

ApplicationMethodOutcome
Gene therapyAd-TUSC3 viral delivery Reverts tumor suppressive pathways
Antibody developmentTUSC3-specific antibodies Diagnostics for TUSC3 expression

Therapeutic Potential

  • miRNA targeting: Inhibiting miR-224/-520c to restore TUSC3 expression .

  • TUSC3 reactivation: Designing drugs to rescue mutant TUSC3 function .

  • Biomarker development: TUSC3 expression levels correlate with lymph node metastasis in small-cell lung cancer .

Challenges and Future Directions

  • Context-dependent roles: TUSC3’s function varies across cancer types (e.g., pro-metastatic in NSCLC vs. survival-linked in some tumors) .

  • Delivery barriers: Systemic delivery of recombinant TUSC3 remains challenging due to ER localization requirements .

  • Redundancy in glycosylation: MagT1 compensates for TUSC3 loss in some contexts, limiting therapeutic impact .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please indicate them in your order remarks. We will then prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be decided during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
TUSC3; N33; Tumor suppressor candidate 3; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit TUSC3; Oligosaccharyl transferase subunit TUSC3; Magnesium uptake/transporter TUSC3; Protein N33
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
42-348
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
QKKKENLLAEKVEQLMEWSSRRSIFRMNGDKFRKFIKAPPRNYSMIVMFTALQPQRQCSV CRQANEEYQILANSWRYSSAFCNKLFFSMVDYDEGTDVFQQLNMNSAPTFMHFPPKGRPK RADTFDLQRIGFAAEQLAKWIADRTDVHIRVFRPPNYSGTIALALLVSLVGGLLYLRRNN LEFIYNKTGWAMVSLCIVFAMTSGQMWNHIRGPPYAHKNPHNGQVSYIHGSSQAQFVAES HIILVLNAAITMGMVLLNEAATSKGDVGKRRIICLVGLGLVVFFFSFLLSIFRSKYHGYP YSDLDFE
Uniprot No.

Target Background

Function
TUSC3 functions as an accessory component of the N-oligosaccharyl transferase (OST) complex. This complex catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. This process is known as N-glycosylation. TUSC3 is involved in the N-glycosylation of STT3B-dependent substrates and is specifically required for the glycosylation of a subset of acceptor sites located near cysteine residues. In this function, it appears to act redundantly with MAGT1. In its oxidized form, TUSC3 is hypothesized to form transient mixed disulfides with a glycoprotein substrate, facilitating access for STT3B to the unmodified acceptor site. TUSC3 also has oxidoreductase-independent functions within the STT3B-containing OST complex, potentially involving substrate recognition. Additionally, TUSC3 functions as a magnesium transporter.
Gene References Into Functions
  1. miR-UL112-3p exerts its oncogene function by directly targeting TUSC3 in glioblastoma. PMID: 28303930
  2. A study demonstrated an oncogenic role of TUSC3 in non-small cell lung cancer and showed that dysregulation of TUSC3 may affect tumor cell invasion and migration through possible involvement in the Hedgehog (Hh) signaling pathway. PMID: 28487226
  3. TUSC3 may act as an oncogene in the progression of colorectal cancer. PMID: 30115537
  4. TUSC3 can function both as an oncogene and as a tumor suppressor. (Review) PMID: 28929175
  5. Our data indicate that miR-132 induces temozolomide resistance and promotes the formation of cancer stem cell phenotypes by targeting TUSC3 in glioblastoma. PMID: 28901390
  6. This paper supports the previous clinical descriptions of the condition caused by TUSC3 mutations and describes the seventh family with mutations in this gene, thus contributing to the genetic spectrum of mutations. This is the first report of a family from the Arabian peninsula with this form of intellectual disability. PMID: 27148795
  7. SOX2 regulates the proliferation, migration, and invasiveness of breast cancer cells through miR-181a-5p and miR-30e-5p, which modulate TUSC3 protein levels. PMID: 28288641
  8. Decreased Tumor Suppressor Candidate 3 Predicts Poor Prognosis of Patients with Esophageal Squamous Cell Carcinoma. PMID: 27994502
  9. TUSC3 regulates proliferation and invasion of glioblastoma cells by inhibiting the activity of the Akt signaling pathway. PMID: 27177902
  10. Decreased immunological TUSC3 staining is a prognostic factor for poor survival in pancreatic cancer patients. PMID: 26871953
  11. The TUSC3 gene is associated with mental retardation in the Qinba mountain area in China; the sixth exon of the TUSC3 gene may contribute to the risk of developing the disease. PMID: 25966277
  12. Report frequencies of short tandem repeat markers linked to TUSC3 (MRT7) or NSUN2 (MRT5) genes used for homozygosity mapping of recessive intellectual disability. PMID: 26427135
  13. TUSC3 loss alters the ER stress response and accelerates prostate cancer growth in vivo. PMID: 24435307
  14. Loss of TUSC3 alters the molecular response to endoplasmic reticulum stress. PMID: 25735931
  15. IGFII and N33 methylation status may be related to gastric carcinogenesis. PMID: 25086101
  16. TUSC3 increases glycosylation efficiency for a subset of human glycoproteins by slowing glycoprotein folding. PMID: 24685145
  17. Homozygous deletion in TUSC3 causes syndromic intellectual disability. PMID: 23825019
  18. TUSC3 is a tumor suppressor gene in ovarian cancer. PMID: 23404293
  19. Genotyping and linkage analysis excluded linkage of the GRIK2 gene and TUSC3 gene with mental retardation. PMID: 21557188
  20. A novel nonsense mutation in TUSC3 is responsible for non-syndromic autosomal recessive mental retardation. PMID: 21739581
  21. Analysis of a novel deletion mutation in the TUSC3 gene in a consanguineous Pakistani family that may have a role in autosomal recessive nonsyndromic intellectual. PMID: 21513506
  22. These findings suggest that inactivation through methylation of the putative tumor suppressor genes N-33 may not be associated with colorectal carcinogenesis in UC. PMID: 20505342
  23. Down regulated in ovarian cancer or absent in ovarian cancer and impact survival. PMID: 16270321
  24. N33, STK11 (19p13), and TP53 might play a role in the development of metastasis in larynx and pharynx squamous cell carcinomas. PMID: 17641416
  25. TUSC3 is only the fifth gene implicated in NS-ARMR, and the first for which mutations have been reported in more than one family. PMID: 18452889
  26. A study shows that mutations in two OTase-subunit genes, N33/TUSC3 and IAP, result in autosomal-recessive nonsyndromic mental retardation. PMID: 18455129
  27. Knockdown of either MagT1 or TUSC3 protein significantly lowers the total and free intracellular Mg(2+) concentrations in cell lines. PMID: 19717468

Show More

Hide All

Database Links

HGNC: 30242

OMIM: 601385

KEGG: hsa:7991

STRING: 9606.ENSP00000221167

UniGene: Hs.426324

Involvement In Disease
Mental retardation, autosomal recessive 7 (MRT7)
Protein Families
OST3/OST6 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in most non-lymphoid cells and tissues examined, including prostate, lung, liver, colon, heart, kidney and pancreas.

Q&A

What is TUSC3 and where is it primarily expressed?

TUSC3 (Tumor Suppressor Candidate 3) is a gene located on chromosome 8p22 that encodes a protein involved in the oligosaccharyltransferase (OST) complex responsible for N-linked glycosylation of proteins in the endoplasmic reticulum . TUSC3 shares homologies with the yeast OST complex subunit Ost3p, confirming its evolutionary conservation in protein glycosylation processes . It is abundantly expressed in developing fetal brain and plays a critical role in neurodevelopment, as evidenced by its association with autosomal recessive non-syndromic intellectual disability when mutated . In normal adult tissues, TUSC3 shows varied expression patterns, with its dysregulation being implicated in several cancer types.

How does TUSC3 function at the molecular level?

At the molecular level, TUSC3 functions as a component of the oligosaccharyltransferase complex, localizing to the endoplasmic reticulum where it facilitates the final steps of N-glycosylation of proteins . This post-translational modification is crucial for proper protein folding, quality control, and shuttling . When TUSC3 function is compromised, it leads to alterations in ER structure and activates the unfolded protein response . Specifically, TUSC3 loss causes dilation of rough ER cisternae and detachment of ribosomes, as visualized through transmission electron microscopy (TEM) . These structural changes in the ER trigger stress responses that alter cell phenotype through complex signaling pathways .

What experimental models are typically used to study TUSC3 function?

Researchers typically employ several experimental models to study TUSC3:

  • Cell line models: Studies have utilized various cancer cell lines with altered TUSC3 expression, including:

    • Prostate cancer cell lines: DU145 and PC3

    • Ovarian cancer cell lines: SKOV-3, TR170, and H134

    • NSCLC cell lines

  • Manipulation techniques:

    • Lentiviral vectors carrying TUSC3 shRNA for knockdown experiments

    • TUSC3 plasmids for overexpression studies

  • In vivo models:

    • Xenograft models in immunocompromised mice (NSG mice) for both subcutaneous and intraperitoneal tumor growth assessment

  • Analytical methods:

    • Immunohistochemistry and western blot for protein expression analysis

    • qRT-PCR for gene expression quantification

    • Transmission electron microscopy for ER structure visualization

    • Functional assays: proliferation (CCK8), migration (wound healing assay), invasion (Transwell assay), and colony formation

How do we reconcile TUSC3's apparently contradictory roles in different cancer types?

The dual nature of TUSC3 in cancer biology presents an intriguing research paradox. While initially identified as a tumor suppressor in ovarian, prostate, and pancreatic cancers , TUSC3 has been shown to exhibit oncogenic properties in non-small-cell lung cancer .

To reconcile these contradictory findings, researchers should consider:

  • Tissue-specific context: TUSC3's function may be highly dependent on the cellular context and tissue microenvironment.

  • Genetic background: In prostate cancer studies, TUSC3 loss accelerated xenograft growth specifically in a PTEN-negative background , suggesting its function may be modulated by other genetic alterations.

  • Methodological approach:

    • Comprehensive profiling of multiple cancer types with matched normal tissues

    • Investigation of TUSC3 interaction partners in different cancer contexts

    • Analysis of TUSC3's effects on downstream pathways across cancer types

  • Clinical correlation data: In NSCLC, high TUSC3 expression correlates with lymph node metastases and advanced tumor stage , whereas in other cancers, its loss is associated with progression, suggesting context-dependent functions.

What are the mechanisms by which TUSC3 loss affects the ER stress response?

TUSC3 loss triggers significant alterations in ER structure and function, activating specific stress response pathways:

  • Structural changes: TEM analysis reveals that TUSC3-silenced ovarian cancer cells exhibit abnormal ER morphology similar to tunicamycin-treated cells, including vast dilation of rough ER cisternae and ribosome detachment, even without external stressors .

  • Molecular changes: TUSC3 downregulation affects the expression of ER stress markers:

    • Increased expression of GDF15 in TUSC3-silenced cells regardless of tunicamycin treatment

    • Enhanced expression of TGFβ1 upon induction of ER stress in TUSC3-silenced TR170 cells

    • Altered unfolded protein response (UPR) activation

  • Downstream signaling: ER stress induced by TUSC3 loss results in increased Akt signaling , potentially linking ER dysfunction to enhanced proliferative and survival pathways.

  • Experimental approach: To study this mechanism, researchers can:

    • Use ER stress inducers (e.g., tunicamycin) in conjunction with TUSC3 manipulation

    • Analyze UPR pathway components via western blotting and qRT-PCR

    • Perform time-course experiments to map the sequence of events following TUSC3 loss

How does TUSC3 affect N-glycosylation and which specific proteins are impacted?

Researchers investigating this question should consider:

What is the relationship between TUSC3 and epithelial-mesenchymal transition in cancer progression?

TUSC3 has been implicated in regulating epithelial-mesenchymal transition (EMT), a critical process in cancer metastasis:

  • In NSCLC: TUSC3 knockdown suppresses EMT by downregulating claudin-1, which plays a crucial role in EMT progression . This suggests TUSC3 normally promotes EMT in this context.

  • In ovarian cancer: TUSC3-silenced cells exhibited enhanced migration and more efficient formation of 3D spheroids , phenomena associated with EMT-like properties:

    • TUSC3-silenced cells assembled into 3D aggregates significantly faster than controls

    • Enhanced delamination and peritoneal dissemination capabilities

  • Experimental assessment:

    • Analysis of EMT markers (E-cadherin, N-cadherin, vimentin) in TUSC3-manipulated cells

    • 3D spheroid formation assays and time-lapse imaging

    • Migration and invasion assays with TUSC3 knockdown or overexpression

  • Molecular mediators: Claudin-1 has been identified as a novel target of TUSC3 in promoting EMT , suggesting specific molecular pathways through which TUSC3 influences the EMT program.

What is the connection between TUSC3's roles in intellectual disability and cancer?

TUSC3 presents a unique research opportunity at the intersection of neurodevelopment and oncology:

  • Genetic evidence:

    • Truncating mutations and homozygous germline deletions of TUSC3 are associated with autosomal recessive non-syndromic intellectual disability (AR-NSID)

    • Interestingly, three patients with TUSC3-related intellectual disability studied by Molinari et al. died due to cancer , suggesting a potential mechanistic link

  • Molecular functions:

    • TUSC3's role in N-glycosylation is likely crucial in both neurodevelopment and cancer biology

    • Proper protein folding and quality control in the ER is essential for both neural tissue development and preventing malignant transformation

  • Research approaches:

    • Developmental models examining TUSC3's role in neural tissue formation

    • Investigation of N-glycosylation patterns in brain tissue versus tumor samples

    • Identification of common TUSC3-dependent glycoproteins in neural and cancer contexts

  • Population studies: SNPs from TUSC3 and other AR-NSID genes show no association with normal range intelligence, suggesting genetic divergence between intellectual disability and normal intelligence variation .

What are the optimal methods for manipulating TUSC3 expression in experimental models?

Based on successful experimental approaches documented in the literature:

  • Gene knockdown strategies:

    • Lentiviral vectors carrying TUSC3 shRNA have proven effective in multiple cancer cell lines

    • siRNA approaches for transient knockdown

  • Overexpression systems:

    • TUSC3 plasmid transfection as demonstrated in NSCLC studies

    • Inducible expression systems for temporal control

  • Verification approaches:

    • qRT-PCR for mRNA expression quantification

    • Western blot and immunohistochemistry for protein level verification

    • Functional assays to confirm phenotypic effects

  • Model selection considerations:

    • Cell line selection should account for baseline TUSC3 expression

    • For in vivo studies, both subcutaneous and intraperitoneal xenograft models provide complementary insights

How can researchers effectively study TUSC3's impact on the ER stress response?

A comprehensive approach to studying TUSC3's role in ER stress should include:

  • Stress induction protocols:

    • Tunicamycin treatment (0.2 μg/ml for 24h) has been effectively used to induce ER stress in TUSC3 studies

    • Thapsigargin or DTT as alternative ER stress inducers

  • Structural analysis:

    • Transmission electron microscopy (TEM) to visualize ER morphology changes

    • Care should be taken during sample preparation to avoid artifacts from cell detachment

  • Molecular markers assessment:

    • UPR pathway components: BiP/GRP78, PERK, IRE1α, ATF6

    • Downstream effectors: CHOP, XBP1 splicing, ATF4

    • Stress-induced cytokines: GDF15, TGFβ1

  • Functional outcomes:

    • Cell viability assays under ER stress conditions

    • Analysis of protein folding and secretion efficiency

What techniques are most effective for studying TUSC3's role in N-glycosylation?

To investigate TUSC3's specific role in protein N-glycosylation:

  • Glycoprotein detection methods:

    • Lectin blotting to detect specific glycan structures

    • PNGase F treatment to remove N-linked glycans for comparative analysis

    • Fluorescent labeling of glycoproteins

  • Mass spectrometry approaches:

    • Glycopeptide enrichment followed by MS/MS analysis

    • SWATH-MS for quantitative comparison of glycoprotein profiles

    • Site-specific glycosylation analysis

  • Functional glycosylation assays:

    • Pulse-chase experiments to track glycoprotein maturation

    • Analysis of glycoprotein trafficking using fluorescent reporters

    • Assessment of client protein folding efficiency

  • Interaction studies:

    • Co-immunoprecipitation to confirm TUSC3's association with the OST complex

    • Proximity labeling techniques to identify TUSC3-associated proteins in the ER

How should researchers interpret contradictory findings regarding TUSC3's role across different cancer types?

When confronted with the paradoxical findings regarding TUSC3's role (tumor suppressor vs. oncogene):

  • Contextual framework analysis:

    • Consider tissue of origin and predominant signaling pathways

    • Evaluate genetic background (e.g., PTEN status, p53 mutations)

    • Assess tumor microenvironment factors

  • Experimental validation:

    • Reproduce findings using multiple cell lines and methodologies

    • Confirm TUSC3 manipulation effectiveness at protein and functional levels

    • Use rescue experiments to establish causality

  • Molecular pathway dissection:

    • In prostate cancer, TUSC3 loss enhances Akt signaling

    • In NSCLC, TUSC3 promotes EMT through claudin-1 regulation

    • Distinct downstream effectors may explain different outcomes

  • Clinical correlation:

    • Always correlate experimental findings with patient data

    • Consider stratification based on tumor stage, histological subtype, and genetic background

What is the significance of TUSC3's dual role in development and disease?

The dual involvement of TUSC3 in neurodevelopment and cancer provides important research insights:

  • Developmental perspective:

    • TUSC3's abundant expression in fetal brain suggests critical developmental functions

    • Intellectual disability phenotypes indicate its requirement for proper cognitive development

    • Understanding developmental functions may provide clues to disease mechanisms

  • Disease mechanism integration:

    • N-glycosylation affects both neural development and cancer progression

    • ER stress responses are relevant in both neurodegenerative and malignant conditions

    • Common molecular pathways may be differentially regulated in development versus disease

  • Translational implications:

    • Developmental phenotypes may serve as indicators for cancer susceptibility

    • Therapeutic targeting must consider developmental roles to avoid adverse effects

    • Potential for repurposing existing therapies across neurological and oncological contexts

How can epigenetic patterns of TUSC3 be effectively analyzed and interpreted?

Epigenetic regulation of TUSC3 shows complex patterns requiring careful analysis:

  • Methylation analysis approaches:

    • Bisulfite sequencing of the TUSC3 promoter region

    • Methylation-specific PCR

    • Genome-wide methylation arrays with TUSC3 focus

  • Interpretation challenges:

    • Some studies suggest increased TUSC3 promoter methylation in men vs. women and smokers vs. non-smokers

    • Other studies found no correlation between TUSC3 methylation and gender, smoking, or alcohol abuse

    • These contradictions suggest complex epigenetic regulation patterns

  • Contextual considerations:

    • Population-specific differences may exist

    • Ethnical origin can influence methylation patterns

    • Clinical background factors may affect epigenetic regulation

  • Research recommendations:

    • Large-scale population analyses of TUSC3 expression and epigenetic patterns are necessary

    • Standardized methodologies should be employed for cross-study comparisons

    • Correlation with functional outcomes is essential for interpretation

What are the most promising therapeutic approaches targeting TUSC3-related pathways?

Based on current understanding of TUSC3's functions, several therapeutic approaches merit investigation:

  • Context-specific targeting strategies:

    • Inhibition of TUSC3 in NSCLC where it appears to have oncogenic functions

    • Restoration of TUSC3 function in cancers where it acts as a tumor suppressor

  • ER stress modulation:

    • UPR pathway inhibitors or activators depending on cancer context

    • Compounds that selectively target stress-induced glycosylation alterations

  • Glycosylation-based approaches:

    • Targeting specific glycan structures altered by TUSC3 loss/overexpression

    • Development of glycomimetics to compete with aberrant glycans

  • Pathway-specific interventions:

    • Akt pathway inhibitors in contexts where TUSC3 loss enhances Akt signaling

    • EMT inhibitors in NSCLC where TUSC3 promotes claudin-1-mediated EMT

What technologies are emerging to better understand TUSC3's role in protein quality control?

Cutting-edge technologies that can advance our understanding of TUSC3 include:

  • Single-cell glycoproteomics:

    • Analysis of glycosylation patterns at single-cell resolution

    • Correlation with cellular phenotypes and stress states

  • Live-cell imaging of ER dynamics:

    • Real-time visualization of ER morphology changes upon TUSC3 manipulation

    • Tracking of glycoprotein movement through the secretory pathway

  • Cryo-electron microscopy:

    • Structural characterization of TUSC3 within the OST complex

    • Visualization of conformational changes during glycosylation

  • CRISPR-based screening:

    • Genome-wide screens for genetic interactions with TUSC3

    • CRISPRi/a approaches for nuanced modulation of TUSC3 expression

How can integrated multi-omics approaches enhance our understanding of TUSC3 biology?

Multi-omics integration offers powerful insights into TUSC3's complex biology:

  • Complementary omics platforms:

    • Transcriptomics to identify TUSC3-dependent gene expression changes

    • Proteomics to detect alterations in protein abundance and modification

    • Glycomics to characterize specific glycan structures affected by TUSC3

    • Interactomics to map TUSC3's protein-protein interaction network

  • Integration strategies:

    • Pathway enrichment across multiple omics datasets

    • Network analysis to identify functional modules

    • Temporal profiling to establish cause-effect relationships

  • Clinical correlation:

    • Integration of experimental multi-omics data with patient samples

    • Identification of biomarker signatures associated with TUSC3 status

    • Stratification of patients based on integrated molecular profiles

  • Computational modeling:

    • Predictive models of TUSC3's impact on cellular processes

    • Simulation of N-glycosylation dynamics in normal versus disease states

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.