Recombinant Human Tumor suppressor candidate 5 (TUSC5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TRARG1; IFITMD3; LOST1; TUSC5; Trafficking regulator of GLUT4 1; Dispanin subfamily B member 1; DSPB1; Interferon-induced transmembrane domain-containing protein D3; Protein located at seventeen-p-thirteen point three 1; Tumor suppressor candidate 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-177
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TUSC5
Target Protein Sequence
MAHPVQSEFPSAQEPGSAAFLDLPEMEILLTKAENKDDKTLNLSKTLSGPLDLEQNSQGL PFKAISEGHLEAPLPRSPSRASSRRASSIATTSYAQDQEAPRDYLILAVVACFCPVWPLN LIPLIISIMSRSSMQQGNVDGARRLGRLARLLSITLIIMGIVIIMVAVTVNFTVQKK
Uniprot No.

Target Background

Function
Recombinant Human Tumor suppressor candidate 5 (TUSC5) regulates insulin-mediated glucose uptake and transport in adipose tissue by modulating SLC2A4 recycling. While not essential for initial SLC2A4 membrane fusion, TUSC5 is crucial for proper protein recycling during sustained insulin stimulation.
Gene References Into Functions
  1. Aberrant DNA hypermethylation of TUSC5 in breast cancer suggests an epigenetic mechanism for cancer-associated downregulation. PMID: 23302999
  2. Findings suggest TUSC5 involvement in shared adipose-nervous system functions. PMID: 17689857
Database Links

HGNC: 29592

OMIM: 612211

KEGG: hsa:286753

STRING: 9606.ENSP00000329548

UniGene: Hs.146059

Protein Families
CD225/Dispanin family
Subcellular Location
Cell membrane; Single-pass membrane protein. Endomembrane system; Single-pass membrane protein. Cytoplasm, perinuclear region.
Tissue Specificity
Expressed at high levels in heart, mammary gland, adrenal gland, stomach, smooth muscle and skeletal muscle, and at lower levels in brain and lung. Strongly down-regulated in lung cancer tissues, due to hypermethylation of the corresponding locus. Express

Q&A

What is TUSC5 and where is it primarily expressed?

TUSC5 (Tumor suppressor candidate 5) is a gene that shows distinctly high expression in adipose tissue and neurons. It is abundantly expressed in white adipose tissue (WAT), brown adipose tissue (BAT), and peripheral afferent neurons . The protein is also known by alternative names including IFITMD3 (interferon induced transmembrane protein domain containing 3), LOST1, and "Protein located at seventeen p thirteen point three 1" . TUSC5 belongs to the IFITM (interferon-induced transmembrane) protein family and contains a transmembrane domain characteristic of this family .

How is TUSC5 expression regulated during adipocyte differentiation?

TUSC5 expression dramatically increases during adipogenesis. In 3T3-L1 cells, TUSC5 mRNA increases from trace levels in preadipocytes to high levels in mature adipocytes . This temporal expression pattern suggests TUSC5 plays a role in mature adipocyte function rather than in the differentiation process itself. The regulation occurs at the transcriptional level, with TUSC5 being a direct target of PPARγ (Peroxisome proliferator-activated receptor gamma), a master regulator of adipocyte differentiation and function .

What experimental evidence confirms TUSC5 as a PPARγ target gene?

Several experimental approaches have confirmed TUSC5 as a bona fide PPARγ target gene:

  • Dose-response studies: Induction of TUSC5 mRNA levels in 3T3-L1 adipocytes by PPARγ agonists troglitazone and GW1929 followed a dose-response consistent with these agents' binding affinities for PPARγ .

  • Chromatin immunoprecipitation (ChIP): Experiments confirmed that PPARγ protein binds a ~1.1 kb promotor sequence of murine TUSC5 transiently during 3T3-L1 adipogenesis, concurrent with histone H3 acetylation .

  • Tissue-specific response: TUSC5 expression was not induced appreciably in liver preparations overexpressing PPARs, suggesting tissue-specific factors regulate PPARγ responsiveness of the TUSC5 gene .

What is the basic function of TUSC5 in adipose tissue?

TUSC5 plays a critical role in insulin-stimulated glucose uptake in adipocytes both in vitro and in vivo . Specifically, TUSC5 facilitates the proper recycling of GLUT4 (glucose transporter type 4) and other key trafficking proteins during prolonged insulin stimulation . This enables proper protein localization and complete vesicle formation, processes that ultimately enable insulin-stimulated glucose uptake into adipose tissue . TUSC5 essentially functions as an adipose tissue-specific adaptor protein that links the ubiquitous vesicle traffic machinery with tissue-specific insulin-mediated glucose uptake .

What mechanisms underlie TUSC5's role in GLUT4 trafficking and glucose homeostasis?

TUSC5 regulates insulin-mediated glucose uptake in adipocytes by modulating the GLUT4 storage vesicle (GSV) recycling machinery . At the molecular level, TUSC5 functions as an adipose-specific adaptor protein that links GLUT4 trafficking to the ubiquitous cellular machinery responsible for vesicle formation and recycling .

The mechanism involves:

  • Vesicle formation: TUSC5 enables complete vesicle formation during insulin stimulation.

  • Protein recycling: TUSC5 facilitates proper recycling of GLUT4 and other key trafficking proteins during prolonged insulin stimulation.

  • Protein localization: This recycling is essential for proper protein localization, which ultimately enables insulin-stimulated glucose uptake.

In TUSC5 knockout models, impaired glucose disposal is observed due to defects in these processes, resulting in insulin resistance specifically in adipose tissue .

How does TUSC5 expression correlate with obesity phenotypes and can it serve as a biomarker?

The relationship between TUSC5 expression and obesity presents an interesting paradox based on the available research:

Study PopulationTUSC5 Expression PatternReference
Obese Pima Indians~1.7-fold increase in adipocytes (p=0.003)
Other obese cohorts~2-fold increase in SC and VAT relative to non-obese subjects
Lean vs. obese subjectsNo differences in WAT expression or prevalence of coding region SNPs

TUSC5 expression has been shown to correlate strongly with leptin transcript levels in human subcutaneous and visceral adipose tissue (r = 0.887; p < 0.0001; n = 44) . This suggests TUSC5 expression may reflect adipocyte size or metabolic activity.

Importantly, TUSC5 expression is predictive of glucose tolerance in obese individuals, independent of body weight . This indicates TUSC5 may serve as a potential biomarker for metabolic health in obesity, particularly in identifying the subpopulation of obese individuals who maintain insulin sensitivity despite excess adiposity.

What are the optimal conditions for expressing recombinant human TUSC5 protein for structural and functional studies?

For expression of recombinant human TUSC5 protein, researchers should consider the following methodological approaches:

  • Expression systems: Based on available information about successful expressions, TUSC5 has been expressed in various systems including:

    • E. coli

    • Mammalian cells (particularly HEK293)

    • Other eukaryotic systems

  • Tagging strategies: To facilitate purification and detection, TUSC5 can be expressed with various tags:

    • His tag

    • DDK tag

    • Myc tag

    • Avi tag

    • Fc fusion

  • Antibody selection for detection: Several validated antibodies have been used for TUSC5 detection in western blot analysis:

    • Santa Cruz Biotechnology (SC-292062, 1:1000 dilution)

    • Other commercially available antibodies specific for the chosen tag

  • Buffer conditions: For membrane proteins like TUSC5, consider using mild detergents during purification to maintain proper folding and functionality.

To verify proper expression and functionality, it is advisable to perform western blot analysis alongside functional assays in relevant cell types such as adipocytes.

Generation of TUSC5 Knockout Models:

  • CRISPR-Cas9 methodology:

    • Design gRNAs targeting exonic regions of TUSC5 gene

    • Confirm knockout efficiency by genomic sequencing

    • Validate knockout at protein level by western blot using antibodies such as Santa Cruz Biotechnology SC-292062

  • Phenotype validation:

    • Measure glucose disposal rates using glucose tolerance tests

    • Assess insulin sensitivity in adipose tissue

    • Evaluate GLUT4 trafficking in isolated adipocytes

Generation of TUSC5 Overexpression Models:

  • Vector selection:

    • For in vitro studies, consider lentiviral vectors for stable integration

    • For tissue-specific overexpression in vivo, use adipose-specific promoters like aP2/FABP4

  • Validation approaches:

    • Confirm increased TUSC5 expression by qPCR and western blot

    • Assess functional consequences by measuring glucose uptake

    • Evaluate effects on insulin signaling and GLUT4 trafficking

Expected Phenotypes:

ModelExpected Metabolic PhenotypeMolecular Changes
TUSC5 knockoutImpaired glucose disposal, Insulin resistanceDefective GLUT4 recycling, Incomplete vesicle formation
TUSC5 overexpressionEnhanced glucose uptake, Improved insulin sensitivityIncreased GLUT4 trafficking efficiency

When publishing results, researchers should report both the molecular validation of the model and the comprehensive metabolic phenotyping to establish causality between TUSC5 expression levels and observed phenotypes.

How does TUSC5 contribute to the mechanism of action of PPARγ agonists like thiazolidinediones?

TUSC5 appears to be a critical mediator of the anti-diabetic effects of thiazolidinediones (TZDs) and other PPARγ agonists. Research has established that:

  • TUSC5 is a direct PPARγ target gene, with PPARγ binding to the promoter region during adipogenesis .

  • Treatment with PPARγ agonists increases TUSC5 expression in adipocytes in a dose-dependent manner consistent with these agents' binding affinities for PPARγ .

  • Most significantly, in the absence of TUSC5, the anti-diabetic effects of TZDs are significantly blunted . This indicates that TUSC5 is not merely a marker of PPARγ activation but a functional mediator of TZD therapeutic effects.

  • The mechanism involves TUSC5's role in facilitating insulin-stimulated glucose uptake through proper GLUT4 recycling, a process that is enhanced by TZD treatment .

These findings suggest that TUSC5 induction represents an important component of the therapeutic mechanism of PPARγ agonists, making it a potential target for developing new insulin-sensitizing therapies with fewer side effects than current TZDs.

What approaches can be used to study TUSC5 involvement in insulin signaling pathways?

To thoroughly investigate TUSC5's role in insulin signaling, researchers should employ multiple complementary approaches:

  • Phosphorylation studies:

    • Examine insulin-stimulated Akt phosphorylation (using phospho-Akt antibodies, Cell Signaling #4056)

    • Investigate potential phosphorylation sites on TUSC5 itself that might regulate its activity

  • Protein-protein interaction analysis:

    • Use immunoprecipitation to identify TUSC5 binding partners in the GLUT4 trafficking machinery

    • Employ proximity labeling techniques (BioID, APEX) to map the TUSC5 interactome

    • Validate key interactions through co-immunoprecipitation experiments

  • Vesicle trafficking assays:

    • Utilize live-cell imaging with tagged GLUT4 to monitor vesicle movement

    • Perform subcellular fractionation to track GLUT4 localization in response to insulin

    • Implement TIRF microscopy to visualize membrane fusion events

  • Glucose uptake measurements:

    • Use radiolabeled glucose uptake assays in cells with modified TUSC5 expression

    • Perform hyperinsulinemic-euglycemic clamp studies in TUSC5 knockout mice

  • Structure-function analysis:

    • Generate domain-specific mutants to identify regions of TUSC5 critical for its function

    • Assess the impact of naturally occurring TUSC5 variants on protein function

These methodological approaches can help elucidate the precise mechanisms by which TUSC5 influences insulin signaling and glucose homeostasis, potentially identifying new therapeutic targets for metabolic disorders.

How can machine learning approaches be utilized to explore TUSC5's role in drug discovery?

Machine learning (ML) approaches offer powerful tools for exploring TUSC5's potential in drug discovery, particularly given the complexity of metabolic disease networks. Based on methodologies described in the GeneDisco benchmark , several approaches can be implemented:

  • Active learning for experimental design:

    • Utilize batch active learning algorithms to prioritize TUSC5-related experiments that would yield maximum information gain

    • Integrate prior knowledge from various information sources to guide experimental design

    • Extrapolate to unexplored areas of the experimental space based on available TUSC5 data

  • Target validation approaches:

    • Use ML to assess causal associations between TUSC5 and disease pathologies

    • Implement CRISPR-based genetic interventions guided by ML predictions to validate TUSC5's role

  • Pathway analysis and drug repurposing:

    • Apply network-based machine learning to identify connections between TUSC5 and other metabolic regulators

    • Use these insights to predict existing drugs that might modulate TUSC5 expression or function

  • Structure-based drug design:

    • If structural data becomes available, implement ML-based virtual screening to identify potential TUSC5 modulators

    • Use molecular dynamics simulations enhanced by ML to predict binding modes

  • Biomarker development:

    • Apply ML to multi-omics datasets to identify patterns linking TUSC5 expression with disease progression

    • Develop predictive models using TUSC5 expression data to identify patients who might benefit from targeted therapies

When implementing these approaches, researchers should utilize standardized benchmarks like GeneDisco to evaluate their ML methods and ensure reproducibility and comparability of results across studies.

How do TUSC5 functions differ between adipose tissue and neuronal cells?

TUSC5 exhibits a remarkable tissue-specific expression pattern, being predominantly expressed in adipose tissue and neurons . This dual tissue expression suggests both shared and distinct functions:

TissueConfirmed FunctionsPotential Roles
Adipose Tissue- Regulation of insulin-mediated glucose uptake
- GLUT4 recycling
- Mediator of PPARγ agonist effects
- Lipid metabolism
- Adipokine secretion
- Adipocyte turnover
Neurons- Less well characterized
- Expressed in peripheral afferent neurons
- Potential role in neuronal metabolism
- Possible involvement in sensory function
- May contribute to neuro-adipose communication

The neuronal expression of TUSC5 is particularly intriguing in the context of peripheral afferent neurons, which may play roles in sensing metabolic status and transmitting this information to the central nervous system . This suggests TUSC5 could be involved in neuro-adipose communication pathways that regulate whole-body energy homeostasis.

Methodologically, to study these tissue-specific differences, researchers should:

  • Generate tissue-specific knockout models using Cre-lox systems

  • Perform tissue-specific transcriptomic and proteomic analyses to identify tissue-specific interacting partners

  • Use ex vivo preparations and co-culture systems to study potential communication between TUSC5-expressing neurons and adipocytes

What is the significance of differential TUSC5 expression between subcutaneous and visceral adipose tissue?

Research has demonstrated that TUSC5 exhibits depot-specific expression patterns between subcutaneous (SC) and visceral adipose tissue (VAT), with higher expression typically observed in SC depots . This differential expression has significant implications:

  • Metabolic relevance: SC adipose tissue is generally considered metabolically healthier than VAT. Higher TUSC5 expression in SC may contribute to the superior insulin sensitivity and glucose disposal capabilities of this depot.

  • Clinical correlations: Human studies have shown TUSC5 expression correlates strongly with leptin transcript levels in both SC and VAT (r = 0.887; p < 0.0001; n = 44) , suggesting a relationship with adipocyte function or size.

  • Obesity impact: TUSC5 expression consistently increases in obesity, with approximately 2-fold higher levels in both SC and VAT of obese subjects compared to non-obese individuals . This suggests a potential compensatory mechanism or adaptation to the obese state.

To further investigate this depot-specific expression, researchers should:

  • Compare insulin-stimulated glucose uptake between SC and VAT in relation to TUSC5 expression levels

  • Analyze depot-specific alterations in TUSC5 expression in various metabolic states (fasting, feeding, exercise)

  • Examine the correlation between TUSC5 expression and adipocyte size, inflammatory markers, and insulin sensitivity in different depots

These approaches would provide deeper insights into how depot-specific TUSC5 expression contributes to the metabolic differences between adipose tissue depots and potentially to the pathophysiology of obesity-related metabolic complications.

What protein-protein interactions does TUSC5 engage in to regulate GLUT4 trafficking?

TUSC5 functions as an adaptor protein linking the ubiquitous vesicle trafficking machinery with tissue-specific insulin-mediated glucose uptake into adipose tissue . The specific protein-protein interactions that facilitate this function include:

  • Interactions with GLUT4 trafficking components:

    • TUSC5 likely interacts with components of GLUT4 storage vesicles (GSVs)

    • Potential interaction with Sortilin, a key protein in GLUT4 trafficking that has been studied alongside TUSC5

    • May interact with Cellugyrin, another vesicle-associated protein examined in TUSC5 research

  • Insulin signaling pathway interactions:

    • While not directly established, TUSC5 function intersects with insulin signaling components

    • Research has examined relationships with Akt phosphorylation status

To comprehensively map TUSC5 interactome, researchers should employ:

  • Proximity labeling techniques like BioID or APEX2

  • Co-immunoprecipitation followed by mass spectrometry

  • Yeast two-hybrid screening

  • Mammalian two-hybrid systems for validation

Identification of these interaction partners would provide deeper insights into how TUSC5 coordinates GLUT4 trafficking and potentially reveal new therapeutic targets for improving insulin sensitivity.

How does TUSC5 expression relate to other adipocyte genes and what transcriptional networks regulate it?

TUSC5 exists within a complex transcriptional network in adipocytes. Key relationships include:

  • Co-regulated genes:

    • TUSC5 expression patterns show similarities with γ-Synuclein, another adipocyte-neuron gene that increases during adipogenesis and is elevated in obesity

    • TUSC5 expression correlates strongly with leptin transcript levels (r = 0.887; p < 0.0001; n = 44) , suggesting shared regulatory mechanisms or functional relationships

  • Transcriptional regulation:

    • PPARγ directly regulates TUSC5 expression by binding to its promoter region

    • Histone H3 acetylation occurs concurrently with PPARγ binding during adipogenesis, indicating chromatin remodeling as part of TUSC5 regulation

    • Tissue-specific factors appear to influence PPARγ responsiveness of the TUSC5 gene, as expression is not induced in liver preparations overexpressing PPARs

  • Adipogenesis program:

    • TUSC5 expression dramatically increases during adipocyte differentiation, similar to other adipocyte-specific genes

    • Expression may be influenced by other master regulators of adipogenesis beyond PPARγ

To further elucidate these networks, researchers should:

  • Perform ChIP-seq for multiple transcription factors in adipocytes

  • Use ATAC-seq to identify open chromatin regions near the TUSC5 gene

  • Implement single-cell RNA-seq to identify co-expression patterns at the cellular level

  • Conduct promoter analysis to identify additional regulatory elements beyond PPARγ binding sites

Understanding these transcriptional networks could reveal how TUSC5 expression is coordinated with the broader adipocyte differentiation and function programs, potentially identifying new targets for metabolic intervention.

What is the potential of TUSC5 as a biomarker for metabolic health in human populations?

TUSC5 shows promise as a biomarker for metabolic health based on several observations from human studies:

  • Predictive value for glucose tolerance:

    • TUSC5 expression is predictive of glucose tolerance in obese individuals, independent of body weight

    • This suggests TUSC5 may help identify metabolically healthy versus unhealthy obesity phenotypes

  • Consistent elevation in obesity:

    • TUSC5 mRNA levels consistently increase in obesity, with approximately 1.7-fold increase in obese Pima Indian adipocytes (p=0.003) and approximately 2-fold increase in subcutaneous and visceral adipose tissue of other obese cohorts

    • This pattern suggests TUSC5 may reflect adipocyte adaptation to obesity

  • Correlation with metabolic markers:

    • TUSC5 expression strongly correlates with leptin transcript levels in human subcutaneous and visceral adipose tissue (r = 0.887; p < 0.0001; n = 44)

    • This indicates potential utility in multi-marker panels for metabolic risk assessment

To validate TUSC5 as a clinical biomarker, researchers should:

  • Conduct large-scale prospective studies measuring TUSC5 expression in relation to development of insulin resistance and type 2 diabetes

  • Evaluate TUSC5 protein levels in readily accessible samples (plasma, circulating exosomes) to determine feasibility as a non-invasive biomarker

  • Assess changes in TUSC5 expression in response to therapeutic interventions for metabolic disease

These efforts would help establish whether TUSC5 measurements could provide clinically useful information for personalized approaches to obesity management and diabetes prevention.

How might TUSC5-targeted therapies be developed for metabolic disorders?

Based on current understanding of TUSC5 function, several therapeutic strategies could be developed:

  • Enhancing TUSC5 expression or activity:

    • Development of small molecules that increase TUSC5 expression or enhance its function

    • This approach might improve insulin sensitivity by promoting more efficient GLUT4 trafficking

    • Could potentially provide similar benefits to PPARγ agonists but with fewer side effects

  • Targeting TUSC5 in combination therapies:

    • TUSC5 modulators could be combined with existing diabetes treatments

    • Given that TUSC5 mediates some effects of TZDs, combination therapy might allow for lower doses of TZDs while maintaining efficacy

  • Depot-specific targeting:

    • Developing approaches to selectively enhance TUSC5 activity in subcutaneous adipose tissue

    • This could promote metabolically beneficial adipose expansion in SC rather than VAT depots

  • Screening methodologies:

    • Establish cell-based assays measuring TUSC5-dependent GLUT4 trafficking

    • Develop high-throughput screens for compounds that modulate TUSC5 expression or function

    • Utilize emerging machine learning approaches like those described in GeneDisco to optimize experimental design in drug discovery

  • Precision medicine approaches:

    • Identify patient subgroups with TUSC5 polymorphisms or expression patterns that might predict response to specific therapies

    • Develop targeted interventions based on individual TUSC5 expression profiles

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.