Recombinant Human Type I iodothyronine deiodinase (DIO1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your preferred tag type for prioritized development.
Synonyms
DIO1; ITDI1; TXDI1; Type I iodothyronine deiodinase; 5DI; DIOI; Type 1 DI; Type-I 5'-deiodinase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-249
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
DIO1
Target Protein Sequence
MGLPQPGLWLKRLWVLLEVAVHVVVGKVLLILFPDRVKRNILAMGEKTGMTRNPHFSHDN WIPTFFSTQYFWFVLKVRWQRLEDTTELGGLAPNCPVVRLSGQRCNIWEFMQGNRPLVLN FGSCTUPSFMFKFDQFKRLIEDFSSIADFLVIYIEEAHASDGWAFKNNMDIRNHQNLQDR LQAAHLLLARSPQCPVVVDTMQNQSSQLYAALPERLYIIQEGRILYKGKSGPWNYNPEEV RAVLEKLHS
Uniprot No.

Target Background

Function
Recombinant Human Type I iodothyronine deiodinase (DIO1) is responsible for the deiodination of thyroxine (T4) to triiodothyronine (T3) and the subsequent deiodination of T3 to 3,3'-diiodothyronine (T2). It plays a crucial role in peripheral T3 production through T4 deiodination in tissues such as the liver and kidney.
Gene References Into Functions
The following studies highlight the diverse roles and associations of DIO1:
  1. Serum DIO1 concentration inversely correlated with TNF-alpha in chronic renal failure patients, suggesting DIO1's potential role in TNF-alpha inhibition. (PMID: 30152254)
  2. DIO1 concentration and FT3 levels showed no association with serum 8-Isoprostane. (PMID: 29894998)
  3. Reduced DIO1 mRNA/protein expression observed in depressive disorder patients compared to controls. (PMID: 29182613)
  4. Minor DIO1 variations associated with decreased well-being in Korean hypothyroid patients. (PMID: 28466400)
  5. DIO1 rs2235544 SNP modified the association between organochlorine compound exposure (HCB and PCB153) and maternal thyroid hormone levels. (PMID: 28395858)
  6. Suppressed DIO1 expression may promote cancer cell proliferation. (PMID: 29272308)
  7. LXRalpha regulates DIO1 expression and thyroid hormone activation. (PMID: 28617824)
  8. DIO1 gene implicated in depression. (PMID: 27351946)
  9. Functional DIO1 variants affecting T3 levels showed no association with cognitive function. (PMID: 26866568)
  10. Oxidative stress downregulates T4 to T3 conversion via DIO1 in HepG2 cells. (PMID: 26947333)
  11. Differential expression of D1, D2, and D3 in endothelial cells after thyroid hormone exposure. (PMID: 25304215)
  12. Expression and role of T3 receptors and type I 5'-deiodinase in breast carcinomas, benign breast diseases, lactational changes, and normal breast epithelium. (PMID: 24162265)
  13. DIO1 polymorphisms show relationships with thyroid hormone parameters, IGF-1 production, and depression risk. (PMID: 24878678)
  14. Posttranscriptional regulation of DIO1 and its deregulation in pituitary adenoma due to disturbed SF2/ASF expression. (PMID: 23462647)
  15. Type 1 deiodinase exhibits catalysis-induced activity loss. (PMID: 22544951)
  16. Investigation of DIO1 and DIO2 activities in thyroid tissues from various conditions. (PMID: 22207295)
  17. D1-C785T polymorphism correlates with pre-eclampsia severity. (PMID: 22339181)
  18. FOXA1 and FOXA2 regulate DIO1 mRNA expression. (PMID: 22067325)
  19. miRNA-mediated regulation of Type 1 iodothyronine deiodinase in clear cell renal cell carcinoma. (PMID: 21912701)
  20. DIO1 rs11206244 SNP associated with major depression in White females. (PMID: 21563302)
  21. Review of recent advances in the biochemical and molecular properties of D1 and its role in human physiology. (PMID: 21415143)
  22. Lower enzymatic activity in hemangiomas compared to healthy liver tissue. (PMID: 20049650)
  23. 5'-deiodinase activity in normal pituitary tissue and pituitary adenomas. (PMID: 12153750)
  24. Homodimerization of iodothyronine deiodinases types 1, 2, and 3. (PMID: 12586771)
  25. D1 contains a glycoside hydrolase clan GH-A-like structure. (PMID: 12847093)
  26. Underexpression of DIO1 and DIO2 in papillary thyroid carcinomas. (PMID: 15785240)
  27. Review of factors influencing D1 levels and circulating T4 and T3 concentrations. (PMID: 16131326)
  28. Association of D1a-C/T and D1b-A/G polymorphisms with iodothyronine levels in the elderly. (PMID: 17105838)
  29. Presence of type 1 5'-deiodinase in well-differentiated breast cancer tissue. (PMID: 17274741)
  30. Role of type 1 and type 2 5'-deiodinase in the pathophysiology of McCune-Albright syndrome. (PMID: 18349068)
  31. HNF4alpha regulates thyroid hormone homeostasis through Dio1 gene regulation with GATA4 and KLF9. (PMID: 18426912)
  32. Common genetic variation in DIO1 alters deiodinase function and the balance of circulating free T3 to free T4. (PMID: 18492748)
  33. D1-C785T polymorphism is significantly associated with serum thyroid hormone levels. (PMID: 18793344)
  34. Functional polymorphism in type 1 deiodinase associated with enhanced antidepressant effect of sertraline by triiodothyronine. (PMID: 19064291)
Database Links

HGNC: 2883

OMIM: 147892

KEGG: hsa:1733

STRING: 9606.ENSP00000354643

UniGene: Hs.251415

Protein Families
Iodothyronine deiodinase family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is the primary function of Type I Iodothyronine Deiodinase (DIO1)?

Type I Iodothyronine Deiodinase (DIO1) is an essential enzyme responsible for the deiodination of T4 (3,5,3',5'-tetraiodothyronine) into T3 (3,5,3'-triiodothyronine) and of T3 into T2 (3,3'-diiodothyronine). This enzyme plays a crucial role in maintaining thyroid hormone homeostasis by providing a significant source of plasma T3 through the deiodination of T4 in peripheral tissues, primarily in the liver and kidney. DIO1 belongs to the iodothyronine deiodinase family and is unique in that it can catalyze both outer ring deiodination (ORD) and inner ring deiodination (IRD) .

What distinguishes DIO1 from other deiodinase enzymes?

DIO1 possesses several distinctive characteristics that differentiate it from other deiodinase enzymes:

  • It has a relatively high Michaelis constant (Km) for its substrates T4 and reverse T3 (rT3)

  • It can catalyze both outer ring deiodination (ORD) and inner ring deiodination (IRD)

  • It is susceptible to inhibition by propylthiouracil (PTU)

  • The DIO1 gene is uniquely induced at the transcriptional level by T3, its own end product

  • It is predominantly expressed in peripheral tissues such as liver and kidney

This enzyme is particularly important in peripheral T3 production and maintaining circulating T3 levels, whereas other deiodinases may have more tissue-specific roles in regulating local thyroid hormone concentrations .

What are the key considerations when designing experiments to study DIO1 function?

When designing experiments to study DIO1 function, researchers should implement a systematic approach based on established experimental design principles:

  • Variable definition: Clearly identify independent variables (e.g., DIO1 expression levels, specific mutations, cytokine exposure) and dependent variables (e.g., T3/T4 ratio, enzyme kinetics, catalytic activity)

  • Hypothesis formulation: Develop specific, testable hypotheses based on previous knowledge of DIO1 function

  • Control implementation: Include appropriate controls to account for extraneous variables that might influence results (e.g., cell passage number, transfection efficiency)

  • Subject assignment: For in vivo studies, properly randomize subjects to experimental groups to minimize bias

  • Measurement precision: Employ validated methods for measuring DIO1 activity, such as radioactive iodine assays with appropriate substrate concentrations

To ensure reliable results, researchers must also consider potential confounding factors specific to DIO1 research, such as selenium availability (essential for selenocysteine incorporation) and the influence of cytokines on DIO1 expression and activity .

How should researchers design in vitro assays to measure DIO1 enzymatic activity?

In designing in vitro assays for DIO1 enzymatic activity, researchers should consider the following methodological approaches:

Substrate selection and concentration: Use 125I-labeled substrates (typically T4 or rT3) at various concentrations (0.1-20μM) to determine enzyme kinetics. For initial screening, 1μM 125I-T4 is often appropriate for detecting differences in catalytic activity .

Expression system: Human embryonic kidney epithelial cells (HEK293) transiently transfected with expression vectors containing wild-type or mutant DIO1 constructs serve as an effective model system. Co-transfection with a reporter gene (e.g., GFP) helps normalize for transfection efficiency .

Enzyme kinetics determination: To properly characterize DIO1 activity, determine both Vmax (maximum reaction velocity) and Km (substrate concentration at half-maximum velocity) parameters through substrate concentration curves. This approach can distinguish between mutations affecting catalytic efficiency versus substrate affinity .

Inhibitor studies: Include propylthiouracil (PTU) inhibition studies to confirm the specific activity of DIO1 versus other deiodinases.

Data analysis and presentation: Results should be presented as enzymatic activity relative to wild-type control, with statistical analysis of differences in both Vmax and Km values.

What experimental designs are most effective for studying DIO1 in animal models?

For animal studies investigating DIO1 function, several experimental designs have proven effective:

  • Knockout and knockdown models: Traditional Dio1 knockout mice or conditional knockouts using Cre-lox systems provide insights into the physiological role of DIO1. The phenotype typically includes elevated serum rT3 and slightly elevated T4 .

  • Adenoviral expression systems: For rescue experiments or overexpression studies, adenoviral vectors provide effective hepatic-targeted expression. Tail vein injections of adenovirus infect mouse liver approximately 10-fold more efficiently than other organs, making this approach particularly suitable for DIO1 studies focusing on liver function .

  • Illness models: LPS (lipopolysaccharide) administration serves as an effective model for nonthyroidal illness syndrome, allowing researchers to study the role of DIO1 in this condition. This approach can be combined with adenoviral expression of regulatory factors like SRC-1 .

  • Measurement timing: The timing of measurements is critical, as DIO1 expression and activity can vary with circadian rhythms and in response to feeding status. Sequential measurements over time provide more comprehensive data than single time points.

  • Comprehensive phenotyping: Beyond measuring serum thyroid hormone levels, comprehensive phenotyping should include tissue-specific T3 and T4 levels, gene expression analysis of T3-responsive genes, and metabolic parameters.

How do specific mutations in the DIO1 gene affect enzyme kinetics and thyroid hormone metabolism?

Recent research has identified the first reported DIO1 mutations in humans with thyroid hormone metabolism defects. Two particular mutations provide important insights into structure-function relationships:

  • N94K mutation (c.282C>A, N-linker region): This heterozygous missense variant results in higher serum rT3, T4, and free T4 compared to unaffected relatives, while maintaining normal TSH levels. Functional studies revealed:

    • 44.7% reduction in catalytic activity compared to wild-type

    • Similar Vmax (53.7 vs. 40.9 for wild-type)

    • Higher Km (16.4 vs. 6.0 for wild-type), indicating reduced substrate affinity

  • M201I mutation (c.603G>A, thioredoxin-fold): This heterozygous missense variant presents with:

    • Slightly elevated TSH

    • Higher serum rT3

    • Normal T4 levels

    • Lower T3/T4 ratio compared to unaffected family members

    • 54.1% reduction in catalytic activity

    • Similar Vmax (58.8 vs. 42.0 for wild-type)

    • Higher Km (21.4 vs. 6.9 for wild-type)

These findings demonstrate that DIO1 mutations primarily affect substrate affinity rather than maximum catalytic capacity, resulting in altered thyroid hormone profiles that align with the predicted phenotype from animal models .

What is the role of DIO1 in nonthyroidal illness syndrome and how can this be experimentally investigated?

Nonthyroidal illness syndrome (NTIS) is characterized by decreased circulating T3 levels during serious illness. Research indicates that cytokine-induced decrease in hepatic DIO1 contributes significantly to this syndrome:

  • Cytokine effects: IL-1 and other inflammatory cytokines block T3-mediated induction of DIO1, creating a downward spiral of reduced T3 production and further decreased DIO1 expression.

  • Coactivator involvement: Steroid receptor coactivator 1 (SRC-1) becomes rate-limiting in the presence of inflammatory cytokines. Forced expression of SRC-1 can prevent the cytokine-induced decrease in DIO1 expression.

Experimental approaches to investigate this mechanism include:

In vitro studies: Primary cultures of rat hepatocytes treated with T3 and increasing doses of IL-1, with or without SRC-1 overexpression, reveal that:

  • T3 normally induces DIO1 mRNA approximately 6-fold

  • IL-1 inhibits this T3 induction in a dose-dependent manner (reduced to 2-fold at 10 ng/ml IL-1)

  • Forced SRC-1 expression prevents the IL-1 effect, maintaining the 6-fold induction even in the presence of 10 ng/ml IL-1

In vivo studies: LPS-treated mice with adenoviral SRC-1 expression demonstrate:

  • Prevention of the LPS-induced decrease in hepatic DIO1 mRNA and enzyme activity

  • Maintenance of normal circulating T3 levels despite endotoxin exposure

What is the relationship between DIO1 polymorphisms and thyroid hormone levels in different populations?

Research on DIO1 polymorphisms has revealed significant associations with thyroid hormone levels across various populations. While specific data wasn't provided in the search results, a synthesis of current research indicates:

  • Common polymorphisms: Several common DIO1 polymorphisms (including rs2235544 and rs11206244) have been associated with altered serum T3/T4 ratios.

  • Population differences: The frequency and effect size of these polymorphisms vary between ethnic groups, requiring population-specific studies.

  • Clinical significance: Most polymorphisms result in subtle changes in thyroid hormone levels that remain within the reference range, but may influence individual responses to thyroid hormone replacement therapy.

  • Research methodology: Association studies require:

    • Large sample sizes to detect subtle effects

    • Careful control for confounding factors (iodine status, age, sex, BMI)

    • Comprehensive thyroid function testing (TSH, free T4, free T3, rT3)

    • Genotyping quality control measures

What are the optimal methods for expressing and purifying recombinant human DIO1 protein?

For expressing and purifying recombinant human DIO1 protein, researchers should consider multiple expression systems based on experimental requirements:

Wheat germ expression system:

  • Suitable for producing DIO1 protein fragments (e.g., amino acids 35-125)

  • Advantages include proper folding of complex proteins and reduced endotoxin levels

  • Yields protein suitable for ELISA and Western blot applications

Mammalian cell expression:

  • HEK293 cells are commonly used for functional studies of DIO1

  • Allows for post-translational modifications, including selenocysteine incorporation

  • Essential for enzymatic activity assays

  • Can be scaled using stable cell lines or transient transfection approaches

Purification approaches:

  • Affinity tags (His, GST, or FLAG) facilitate purification but may affect activity

  • Careful buffer selection is crucial to maintain selenocysteine integrity

  • Activity measurements should be performed at each purification step

  • When using tagged proteins, tag removal and activity comparison is advisable

How can researchers effectively measure changes in DIO1 expression at the transcriptional level?

To effectively measure DIO1 expression at the transcriptional level, researchers should employ a combination of techniques:

  • Northern blot analysis: This traditional method provides reliable quantification of DIO1 mRNA, as demonstrated in studies of IL-1 effects on T3-induced DIO1 expression in rat hepatocytes .

  • Quantitative RT-PCR: Offers greater sensitivity and higher throughput than Northern blotting. Important considerations include:

    • Selection of appropriate reference genes that remain stable under experimental conditions

    • Primer design that spans exon-exon junctions to avoid genomic DNA amplification

    • Validation of amplification efficiency across the dynamic range of expression

  • Promoter-reporter assays: Human DIO1 promoter-luciferase constructs allow assessment of transcriptional regulation in response to various stimuli or mutations. This approach has been used to study the effects of IL-1 on T3-induced DIO1 expression .

  • RNA-Seq: Provides comprehensive transcriptome analysis, allowing examination of DIO1 expression in the context of broader gene expression changes.

For all methods, appropriate experimental controls are essential, including:

  • Positive controls (known inducers of DIO1, such as T3)

  • Negative controls (untreated or vehicle-treated samples)

  • Time course measurements to capture dynamic changes in expression

What techniques are used to analyze the kinetics of DIO1 enzyme activity?

Analysis of DIO1 enzyme kinetics requires specialized techniques due to the nature of the deiodination reaction. The following methodological approaches are commonly employed:

Radioactive substrate assays:

  • 125I-labeled substrates (T4, T3, or rT3) are incubated with the enzyme

  • Released 125I is separated from remaining substrate and quantified

  • Multiple substrate concentrations (typically 0.1-20μM) are used to generate Lineweaver-Burk or Eadie-Hofstee plots

  • Km and Vmax values are calculated to characterize enzyme kinetics

Experimental parameters that must be controlled:

  • Reaction temperature (typically 37°C)

  • pH (usually 7.0-7.4)

  • Presence of reducing agents (dithiothreitol)

  • Cofactor availability (selenocysteine)

  • Reaction time (linear range of product formation)

Data analysis and interpretation:
The analysis of kinetic data from DIO1 mutants compared to wild-type enzyme reveals important functional information. For example, in studies of the N94K and M201I mutations:

Protein VariantRelative Activity (%)VmaxKmInterpretation
Wild-type DIO110040.9-42.06.0-6.9Normal catalytic activity and substrate affinity
DIO1-N94K55.353.716.4Normal catalytic capacity but reduced substrate affinity
DIO1-M201I45.958.821.4Normal catalytic capacity but significantly reduced substrate affinity

These data demonstrate that both mutations primarily affect substrate binding rather than the catalytic mechanism itself, providing insight into structure-function relationships .

How should researchers interpret discrepant thyroid function tests in relation to DIO1 function?

Interpreting discrepant thyroid function tests requires systematic analysis of the thyroid hormone profile and consideration of DIO1's role:

  • Key indicators of DIO1 dysfunction:

    • Elevated reverse T3 (rT3) - a highly sensitive marker

    • Normal or elevated T4 with normal or low T3

    • Decreased T3/T4 ratio

    • Normal TSH (in isolated DIO1 deficiency)

  • Differential diagnoses to consider:

    • Nonthyroidal illness syndrome (NTIS)

    • Primary thyroid disorders

    • Medications affecting thyroid hormone metabolism

    • Other deiodinase defects (DIO2, DIO3)

  • Family studies: Assessment of thyroid function tests in family members can help identify patterns consistent with genetic variants. Family members with DIO1 mutations show characteristic patterns:

    • N94K mutation carriers: Higher serum rT3, T4, and free T4 than unaffected relatives

    • M201I mutation carriers: Slightly elevated TSH, higher serum rT3, normal T4, lower T3/T4 ratio

  • Functional validation: Discrepant thyroid function tests potentially related to DIO1 dysfunction should be confirmed through functional studies of enzyme activity, particularly when novel variants are identified.

What statistical approaches are most appropriate for analyzing DIO1 enzymatic activity data?

When analyzing DIO1 enzymatic activity data, appropriate statistical approaches depend on the experimental design and research questions:

  • Comparing enzymatic activities between variants:

    • For normally distributed data: Paired or unpaired t-tests (two groups) or ANOVA with post-hoc tests (multiple groups)

    • For non-normal distributions: Non-parametric alternatives (Mann-Whitney U test, Kruskal-Wallis test)

    • Express results as percentage of wild-type activity with 95% confidence intervals

  • Enzyme kinetics analysis:

    • Non-linear regression for determining Km and Vmax using the Michaelis-Menten equation

    • Bootstrap or jackknife resampling to estimate confidence intervals for kinetic parameters

    • Statistical comparison of curves using extra sum-of-squares F test

  • In vivo studies:

    • Mixed-effects models for longitudinal data accounting for repeated measures

    • ANCOVA when controlling for covariates like body weight or age

    • Power analysis to ensure adequate sample sizes, particularly important for detecting subtle phenotypes in heterozygous models

  • Reporting requirements:

    • Include sample sizes, measures of central tendency, and dispersion

    • Report exact p-values rather than threshold ranges

    • Consider correction for multiple comparisons when appropriate

    • Include both raw data and normalized results when possible

How can researchers effectively integrate in vitro findings with in vivo phenotypes in DIO1 research?

Integrating in vitro findings with in vivo phenotypes presents challenges but is essential for comprehensive understanding of DIO1 function:

  • Translational framework: Develop a systematic approach that connects:

    • Molecular events (e.g., mutations affecting substrate binding)

    • Cellular phenotypes (e.g., reduced T3 production in cultured cells)

    • Tissue-specific effects (e.g., altered hepatic gene expression)

    • Systemic consequences (e.g., changes in circulating thyroid hormone levels)

  • Quantitative relationships: Establish quantitative relationships between:

    • Degree of enzymatic impairment in vitro

    • Magnitude of thyroid hormone alterations in vivo

    • For example, the ~50% reduction in DIO1 activity from N94K and M201I mutations correlates with specific patterns of altered thyroid hormone levels

  • Complementary approaches:

    • Use adenoviral expression systems to test whether forced expression of wild-type DIO1 can rescue in vivo phenotypes

    • Employ precision mutagenesis (e.g., CRISPR/Cas9) to introduce specific mutations identified in humans into animal models

    • Utilize tissue-specific inducible systems to distinguish developmental from adult phenotypes

  • Pathway analysis: Examine broader effects beyond direct DIO1 activity:

    • Analyze expression of T3-responsive genes in various tissues

    • Consider compensatory mechanisms involving other deiodinases

    • Assess potential impacts on metabolic pathways influenced by thyroid hormones

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.